KEGG   Pontibacter actiniarum: CA264_21150Help
Entry
CA264_21150       CDS       T05632                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pact  Pontibacter actiniarum
Pathway
pact00030  Pentose phosphate pathway
pact01100  Metabolic pathways
pact01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pact00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CA264_21150
Enzymes [BR:pact01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     CA264_21150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N UDPG_MGDP_dh_N 2-Hacid_dh_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ARS38058
UniProt: A0A1X9YYU2
Position
unnamed:96234..97343
Genome map
AA seq 369 aa AA seqDB search
MKALSLTPHSWQLDLIDVPEPRIVFPNQVKLSVLEVGICGTDREQVVQKNVEEPAGPQGL
VIGHEMLGQVVEIGTEVRSVRVGDLAVVTVRRGCGLCKPCRNNRSDMCYTGLYKERGIKG
LNGYETEYVVEEELYVVKVPESIRELGVLTEPMSVAEKAIDEAQNVQAARLPEVAGEGWL
AGKKTLVAGLGPIGLLAAVALRLRGAEVIGMDIVDETTKRPLILKELGGQYLDGRKVSAL
EIDERYGQVDFIFEATGIAKLGFELIDALGVNGIYVMTGIPHGDRPVCILGAELIKQMVL
KNQIILGSVNAGIQHFELAIEDLQRAKQRWGNLTTNIITTRVSYQQFSSALNFRSVDDIK
TVIEWNGTD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgtccctaacacctcattcctggcagctggatttaatcgatgtgcctgag
cccaggatagttttccctaatcaggttaaactaagcgtactggaggtgggtatctgcggc
acagacagggagcaggtcgtgcagaagaacgtggaagagcctgccgggccccaagggctg
gtgatagggcatgagatgctggggcaggtggtggagataggcacagaggtaagaagcgtt
cgcgtaggggacctggccgtggtaacagtcaggaggggttgcgggctgtgcaagccctgc
aggaataaccgcagcgacatgtgctacacgggtctctataaggaaaggggaatcaaaggc
ctgaatggctatgagacggagtacgtggtggaggaggagctttacgtggtgaaggttccg
gaaagtataagggagctgggcgtgctgacggagccgatgtctgtggcagaaaaggcaatc
gacgaggcgcagaatgtgcaagcggcgcgcctgccagaggtcgccggggaagggtggctt
gcggggaaaaaaacgctggtggccggtcttggtcccatcggcttgcttgcagcggtagcc
ctaagacttcgtggcgccgaggtgatcggaatggacatcgtagacgagactacgaagagg
cctttgatactgaaggaactgggaggccagtatttagatggccgaaaggtgagtgccttg
gagatagatgaacggtacggacaggttgactttatctttgaggccacgggtatagccaag
cttggctttgagctgatcgacgcgctgggagtcaacggaatatatgtgatgacaggcatt
ccgcacggcgaccgccccgtctgcatacttggagcagagctcataaaacagatggttctg
aagaaccaaattatccttgggagcgtgaacgcgggaatacagcattttgagctggccatt
gaggacctgcagcgggccaagcagcggtgggggaacctgactacaaatattattactacc
cgtgtcagttatcagcagttcagcagtgccctcaatttcaggtctgtggatgacattaag
acggtgatagagtggaacggcacggactaa

DBGET integrated database retrieval system