KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_02985Help
Entry
TIIST44_02985     CDS       T01972                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Brite
KEGG Orthology (KO) [BR:pad00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TIIST44_02985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AER05114
Position
complement(651583..652728)
Genome map
AA seq 381 aa AA seqDB search
MSSTLLIVVIVVVTALAFDFTNGFHDSANAMATSVATGALKPKVAVIIAAVLNVIGACLS
TEVAKTISGGIVNDHLVTAPMVFAGLIGAIIWNLATWLFGLPSSSSHALFGGLIGAVLVE
AGMSGIDAGKIMSKIVLPALVAPFVAGIAALVATWLAYRITNHTAHHSSRMFLNGQRVSA
SMVALAHGTSDGQKTMGIITLVLISAGYQASGTGPEWWVILAAGCAIGLGTYSGGWRIMR
TMGKGLCDIESPQGFAAETASTAAILASSHLGFALSTTHVCSGSILGSGIGRHTEVRWAT
AGKMVIAWLVTLPAAALVGAVTSAVAGAGTWGVIVDLGLLAVMAALIVRQANQHKVDHRN
VNDSTQVGVRKGSAVAGGTAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgactctgttaatcgtggtcatcgtcgttgtgacggcgttggcattcgacttc
actaacggcttccacgactcagccaacgctatggcaacgtcggtggcaaccggggcgctc
aagcccaaggtggccgtcatcatcgcggctgtgctcaacgtcattggcgcctgcctgtcg
actgaggtcgccaagacgatctcgggcggtatcgtcaacgaccacctggtgaccgctccc
atggtctttgctggtcttatcggtgccatcatttggaatctggcaacgtggctgttcggt
ctgccatccagctcctcccatgccctctttggtggccttatcggtgctgtgttggttgag
gctggtatgagtggcatcgacgccggcaagatcatgagcaagatcgttctaccggccttg
gttgcccctttcgttgcgggtatcgcggccttagtggccacgtggctggcttaccgcatc
accaaccacactgcgcaccactcttcgcggatgttccttaacggccagcgggtctcagct
tccatggttgctctcgcgcatggcacctctgatggtcaaaagacgatgggcatcattacc
ctggtcctcatttccgctggataccaggcctccggcactggcccagagtggtgggtcatc
ctggctgcggggtgcgccatcggtctaggtacctattcgggtggttggcgcatcatgcgg
accatgggcaaaggtctatgtgatatcgagtctccgcagggttttgcggctgagacggcc
tccactgccgcgatcctggcctcttcgcacctgggcttcgccctgtcgaccacccatgtc
tgttcgggatcgattctgggctcgggtatcggccgtcacactgaggttcgctgggccacc
gctggaaagatggttatcgcgtggctcgtcacgctgccggcggccgctctcgttggtgcc
gtcacctcagccgtcgccggtgccggcacttggggcgtcattgtcgacctcggcttgctg
gctgtcatggccgcactgattgtccgtcaggccaaccagcacaaggttgaccataggaac
gttaacgactccacccaggtgggcgtccgtaagggctccgccgtagccggagggactgca
gcatga

DBGET integrated database retrieval system