KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_03040Help
Entry
TIIST44_03040     CDS       T01972                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00020  Citrate cycle (TCA cycle)
pad00620  Pyruvate metabolism
pad00650  Butanoate metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
pad01130  Biosynthesis of antibiotics
pad01200  Carbon metabolism
Module
pad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIIST44_03040
   00620 Pyruvate metabolism
    TIIST44_03040
   00650 Butanoate metabolism
    TIIST44_03040
Enzymes [BR:pad01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     TIIST44_03040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AER05125
Position
664647..666161
Genome map
AA seq 504 aa AA seqDB search
MSERIANAALRQKVMSADDAAALIHDGDQIGFGGFTGSGYPKELPGALAKRIQESHDRGE
KFTVNVFTGASTAPELDGALASVDGIGWRMPYQSDPQMRSKINDGTSFYTDIHLSESGMM
VRQSFFGKVDFAVIEATRITADGDVVLTSSVGNNAVYCDTAEKVIIEVNSWQSEDLEGMH
DIYGGFALPPNRVPIPITHPGDRIGDKFLHISQNKIVAIVETAGPDRNTPFKPIDDDSRK
IAGFLLDFYDNEVKQGRIPKNLLPLQSGVGNIPNAVLDGLLHSDLEHLTSYTEVIQDGMI
DLIDAGKLDVASATAFSLSPDYAHKMNENAAFYRDHIILRPQEISNHPEVIRRLGVIGAN
GMIEADIYGNVNSTHVMGSRMMNGIGGSGDFTRNAYISAFVSPSTAKGGAISAIVPMVSH
VDHTEHDGMVIITEQGIADLRGLAPRQRAPKIIENCAHPDYRPMLLDYYERALRDCKFKH
TPHLLGEAYSWHTRFLETGTMKKD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcggattgccaacgcagccctgcgtcagaaagtgatgagcgcggacgacgcg
gctgccctcatccatgacggcgaccagatcggattcggtggattcactgggtcgggctac
cccaaagagcttccaggcgcactggccaagcgcatccaagagtcccacgaccgtggtgag
aagttcaccgtcaacgtcttcaccggagcctcgaccgctcctgaactcgacggcgccctc
gcctccgttgacggcatcggctggcgtatgccataccagtccgatccccagatgcgaagc
aagatcaacgacggcacctccttctacaccgacatccatctatcggagtcgggcatgatg
gtgcgtcagagcttcttcggcaaggtcgacttcgccgtcatcgaggccacacgaatcacc
gcggacggggatgtcgtcctcacctcgtcggttggcaacaacgcggtctactgtgacacc
gccgagaaagtcatcatcgaggtcaactcgtggcagtccgaggacctcgaaggaatgcac
gacatctacggtggttttgcgcttcctccgaaccgggtgccgatcccgatcacccatccc
ggtgaccggatcggtgacaaattcctccacatctcccagaacaagattgtggcgatcgtc
gagaccgcaggccccgaccgcaacaccccgttcaagccgatcgacgacgactctcgcaag
atcgccggattcctgctcgacttttatgacaacgaggtcaagcagggacgcatccccaag
aacctgctgccgctccagtccggcgtcggcaacatcccgaacgccgttcttgacggcttg
cttcactccgacctggagcatctgacctcgtacaccgaggtgatccaggacggcatgatc
gacctcatcgatgccggcaagcttgacgtcgcctccgctaccgccttctcgctgtcgcct
gactatgcgcacaagatgaacgagaacgcagccttctaccgcgatcacatcattttgcgc
ccgcaggaaatttcgaaccaccccgaggtcattcgccgcctcggcgtcatcggcgctaac
ggcatgatcgaggccgacatctatggcaatgtcaactcgacccatgtcatgggctcgcgg
atgatgaacggcatcggtggatccggcgacttcacccgcaatgcctacatttcggccttc
gtgtccccgtcgacagccaaggggggcgccatctcggcgatcgtcccgatggtctcccac
gtcgaccacaccgagcacgacggtatggttatcatcaccgagcaaggcatcgctgatctg
cgtggcctggccccacgccagcgcgccccgaagatcatcgagaattgtgcccacccggac
taccgtccgatgctgctcgactactacgagcgtgcgctgcgcgactgcaagttcaagcac
accccgcacctgctgggtgaggcgtactcatggcacacccggttcctcgagaccggcacc
atgaagaaggactga

DBGET integrated database retrieval system