KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_03150Help
Entry
TIIST44_03150     CDS       T01972                                 

Definition
(GenBank) biotin-requiring enzyme
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00010  Glycolysis / Gluconeogenesis
pad00020  Citrate cycle (TCA cycle)
pad00620  Pyruvate metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
pad01130  Biosynthesis of antibiotics
pad01200  Carbon metabolism
Module
pad_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_03150
   00020 Citrate cycle (TCA cycle)
    TIIST44_03150
   00620 Pyruvate metabolism
    TIIST44_03150
Enzymes [BR:pad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TIIST44_03150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H HlyD_D23 DUF3248
Motif
Other DBs
NCBI-ProteinID: AER05147
Position
complement(683483..684892)
Genome map
AA seq 469 aa AA seqDB search
MPDPGEGLTEGEVVSWRVSPGDTVKINDVLCEVETAKSIVELPSPFAGTVAKLCAEPGET
VAVGEPLVTIDDGSDDQPEEEPEFLVGHLTAESGRRRRRRRGAAVSAERAPEKAPQTPTL
KTGPETDVEPVPEPVQPTQPRRQDPPRMDRAGHVLAKPPARRLAADLGIDLSTVTGTGPQ
GAVTRSDVKAAAEAGRQAAPEPPVVGASAGDAEFATLSVMSRRLLGGAPTEPDGHTRRVP
VRGVRKVTAKAMKDSLDTKALVTAFLTCDVTPTMDLVARLRADRRFKGLRVSPLTIWCKA
VCLAMGRTPVVNARWDDAADQIVFRDQINLGIAAATPRGLMVPVVRNAQDMTMLELAEEI
TRIVAIAKEGKLQPTDYTDGTFSITNVGVFGLDAGTPVVNRTESAILVLGTIARRPWVVG
TGDDEEVVPRWVTTMSLGFDHRLIDGEEGSTFLHDVAEILSDPASAMLY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacccgggcgaagggctcaccgagggagaggtcgtctcctggcgggtgtctccc
ggtgacaccgtcaagatcaacgacgtgctgtgcgaggtcgagacggccaagtcgatcgtc
gaactccccagccctttcgccgggaccgtggcgaagctgtgtgccgagcccggcgagacg
gtggctgtgggagagccactggtgaccattgacgacggttccgacgaccaacccgaggag
gagccggagttcctcgtcggtcacctgaccgcggagtccggacgtcgacgccgtcgtcgc
aggggagctgcggtgtcggctgaaagggcacccgagaaggccccccagacgccgaccctc
aagaccggtccagagactgatgtcgagcccgttcccgaacctgtgcagccgacacagccc
aggcgccaggatccgccgcgcatggaccgcgccgggcatgtcctcgccaagcccccggcc
cgacgtctggctgccgacctcggcatcgacctctcgacggtgacgggcaccggcccgcag
ggggcggtgacgaggagcgacgtcaaggcggcagcggaggccggtcgtcaagccgcgcct
gaaccacctgtcgtcggtgcctctgctggcgacgctgagttcgcgaccctgtcggtgatg
tctcgtcgtctccttggcggtgccccgaccgagcctgacggccacactcgcagggtcccg
gtgcgcggcgtccgcaaagtgactgccaaggcgatgaaggattccctggacaccaaggcc
ctcgtgacggccttcctcacctgcgacgtcaccccgacgatggacctcgtcgcccggctg
cgtgccgaccgcaggttcaagggactgcgcgtctccccgctgaccatctggtgcaaggcg
gtgtgcctggcgatgggacgcaccccggtcgtcaacgcccgctgggacgacgccgccgac
cagatcgtcttccgcgaccagatcaacctcggcatcgccgcggccaccccgcgcggcctc
atggtgcccgtggtgcgcaacgcccaggacatgacgatgctcgagctggccgaggagatc
acccgcatcgtcgccatcgccaaggagggaaagctccagcccaccgactacaccgacggc
accttctcgatcaccaatgttggggtgtttggccttgacgcagggactccggtcgtcaac
cgcaccgaatcggcgatcctcgttctcgggacgatcgctcgacgtccgtgggtcgtcggg
accggtgacgatgaggaggtcgtgcccaggtgggtgacgacgatgagcctcggcttcgac
catcgcctcattgacggcgaggagggctcgaccttcctccatgacgttgcggagattctc
tcggacccggcctcggcaatgctgtactga

DBGET integrated database retrieval system