KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_04220
Entry
TIIST44_04220     CDS       T01972                                 

Definition
(GenBank) D-ornithine aminomutase E component
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00472  D-Arginine and D-ornithine metabolism
pad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    TIIST44_04220
Enzymes [BR:pad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     TIIST44_04220
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AER05351
Position
900949..903249
AA seq 766 aa
MTIQDTCLHHKHVREREQLGPNNKSAVTSSEPVEPRTEQDPPGPNTKLNVEEILTDLEHY
HPRRKGWTWRNVPEEGIDMGDFHYRNMSTPLKQSMPLPAAEYFENIDPQPAPVVTSEIAS
GHFEDDLRRMRMAAWHGADHIMVIRTTGQSHIDGLLEGTPEGIGGVPITRKQLRASRKAC
DLIEDEVGRPINFHSYVSGVARPEVAVLFAEEGVNGAHQDPQYNLLYRNINAYRSYVDAG
EAKKVMAGAQIFQIDGAHNANATARHGWKVMPELMVQHGLNCMYSVLVGIPKDLIGLSTV
PPSAPPAPKLWYDLPYAVALRDLFSEYKMRAQQNTRYIESDLAEAIRTHTIDTLISMLTS
ADIQSTITPDEGRNLPWHHNSVRGVQTVKQTWAALDGIKEMVTINREGPLGHMVRDLKER
AIGFLTEMLHVGGYFVAVEDGFFVDSAEFPERNHDGIARDGQGGIAEGTVVERDPDYLAP
VCDHFGNNNLPEGLNKPCDLIDGCTLCEPEKIVYIDELDPNDSAATRLACTRPFRDGTAL
RPEAEWAGDGVVLVQMNIAREAAVEMARKMGITDPQVCNLQVLHPAEGCFVEVKGQATHV
DVNPSKLTIPEKIELLPADELRQFVTDHELSVVAGTVGEDEHSVGLREILDIKHGGIEKY
GVKYRYLGTSVPVEKMVDAAIESGADAILISTIISHNDIHRTMMRKLADLATEKGIRDKV
VLVAGGTQVNREMAAETGLDATFGRGTKGIDVLDAIVRTMRTRAEA
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgactatccaagacacgtgcctgcaccacaagcacgtccgcgaacgcgagcaactcggc
ccgaataacaagtccgccgtgacgtcttcggagcccgtcgagccccgcaccgagcaggac
cccccaggcccgaataccaaactcaatgtcgaggagatcctcaccgaccttgagcactac
cacccccgtcgcaagggatggacctggcggaacgtgccggaagagggaatcgacatgggc
gacttccattaccggaacatgtccaccccgttgaagcagagcatgcctctgcccgccgca
gagtacttcgagaacattgatccccagccggcacccgtcgtcacctccgagatcgcttcg
gggcacttcgaggacgacctgcgccgtatgaggatggcggcctggcacggagctgaccac
atcatggtcatccgcaccaccggacagagccacatcgacggactactagagggcaccccg
gaaggtatcggcggcgttccgatcacccgtaaacagctgcgcgctagccgcaaggcctgc
gacctcatcgaggacgaggtagggcgccccatcaacttccactcctacgtgtccggagtc
gcccgccctgaggtggccgtcctcttcgccgaagagggggttaacggtgctcatcaagac
ccgcaatacaacctgctgtaccgcaacatcaacgcctaccgcagctatgttgacgccggt
gaagccaagaaggtgatggcgggagctcagatcttccaaatcgacggtgcacacaacgcc
aacgccactgcccggcacggttggaaggtcatgcccgagctcatggtccagcacggcctc
aactgcatgtactcagtgctggtaggaataccgaaggacctcatcggcctgtcgacggtt
ccgcccagcgctcccccggcgccgaaactctggtacgacctgccgtacgcagtggccctg
cgcgatctgttcagcgagtacaaaatgcgcgcccagcagaacacccggtacatcgagtcc
gacctcgccgaggccatccgcacccacaccatcgacactctcatctcaatgctgaccagc
gcggacatccagagcaccatcacccctgatgaaggccgcaacctgccctggcaccacaac
tctgtccgcggcgtccagacggtcaaacagacctgggccgctctcgatggcatcaaggag
atggtgaccatcaaccgcgaggggccactcggccacatggtgcgtgacctcaaggagcgg
gcgatcggtttcctcaccgagatgctgcacgtgggtggctacttcgtcgccgttgaggac
ggattcttcgtcgactcggcagaattcccggaacgcaaccacgacggcatcgcccgtgac
ggccaaggcggaatcgccgagggaaccgtcgtcgagcgtgaccccgactacctcgcccca
gtctgcgaccatttcggcaacaacaacctgcccgagggccttaacaagccgtgcgacctc
atcgacggctgcaccttgtgcgaacccgagaaaatcgtctacatcgatgagctcgacccc
aacgactcggccgcgacccgcctggcctgcacccgcccgttccgcgacggcacagcgcta
cggcccgaggctgaatgggccggtgacggtgtcgtcctggtacagatgaacatcgcccgc
gaggcggccgtcgagatggcacgcaagatgggcatcaccgacccacaggtatgcaacctg
caagtgctgcaccccgccgaaggatgcttcgttgaggtcaaaggccaggcgacccacgtc
gacgtcaacccatccaagctgacgatccccgagaagatcgaactgctacccgccgacgaa
ctacgccaattcgtcaccgaccacgagttgtcggtggtggccggcactgtcggtgaggac
gagcacagcgtcgggctgcgcgagatcctcgacatcaagcacggtggcatcgagaagtac
ggggtgaaatatcgctaccttggcacatcggtgccggtggagaagatggtcgatgccgct
atcgagagtggcgccgacgccatcctcatctccacgatcatcagtcacaacgacatccat
cgcaccatgatgcggaagttggctgatctggccaccgagaagggcatccgcgacaaggtc
gttctcgtcgccggcggcacccaggtgaaccgggagatggcagcagagaccggcttggac
gccaccttcgggcgcggtaccaagggcatcgacgtccttgacgccatcgtgcgcactatg
cggacccgcgcggaagcctga

DBGET integrated database retrieval system