KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_06005Help
Entry
TIIST44_06005     CDS       T01972                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00790  Folate biosynthesis
pad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIIST44_06005
Enzymes [BR:pad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TIIST44_06005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: AER05690
Position
1308192..1308761
Genome map
AA seq 189 aa AA seqDB search
MSVDRERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTFDI
SHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQVQ
ERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRGILRNPATRAE
AMGLITAGR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgttgatcgcgagcgagccgcggcagctatccgcgagtttcttctggcggtcggc
gaggatcccgatcgggaaggtctgcgcgatactccaatgcgagtggcccaggcggccgag
gagctatttggcggattaagccaagatccgggggagttgctggcaacgaccttcgacatc
tcccacgacgagatggtgttggtgcgtgatattgagttgcagtcgatgtgtgagcaccac
ctgctgcccttcatcggggtagcgcacgtcggttatattccggctagggacggccgggtg
acggggttgagcaagatcgcgaggttggtggaggtctatgcgcgtcgaccccaggtacag
gagaggttgacgacccaggtggccgacgccttggtagaacatttggatgctcgtggcgtg
atcgtggtcgttgaggccgagcacatgtgcatgacgacgaggggggtccgcaagccgggg
gcccggacggtgacctccgcggtgcgcgggattctgcgcaacccggcgacgcgggccgag
gcgatggggctgatcacggctggacgttga

DBGET integrated database retrieval system