KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_06205Help
Entry
TIIST44_06205     CDS       T01972                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase, HemL
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00860  Porphyrin and chlorophyll metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pad00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIIST44_06205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pad01007]
    TIIST44_06205
Enzymes [BR:pad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     TIIST44_06205
Amino acid related enzymes [BR:pad01007]
 Aminotransferase (transaminase)
  Class III
   TIIST44_06205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AER05726
Position
complement(1343625..1344935)
Genome map
AA seq 436 aa AA seqDB search
MTSNAELFSAAQAVIPGGVDSPVRAYGSVGGVPRFIEKAQGPWIWDAEGTRYVDLVCTWG
PALLGHARPEVVSAVQEAASKGLSFGAPTRTETELADAIIERMDPVEKVRFVSTGTEATM
TAVRLARGATGRDVIVKFAGNYHGHSDALLAAAGSGVATAGLPGSAGVPAASTADTIVVD
YNDVAALDAVFSERGDQIAAVIVESCPANMGVVPPEPGFNAAIRRLTTEHGALMITDEVL
TGFRCSPSGFWGLQQQAGEDFAPDIFTFGKVVGGGMPLAALGGHADVMDLLAPTGPVYQA
GTLSGNPLATVAGVKTLQLADAEVYQRLDVRSEKWRNELESALDAAGVTYRLQNAGNLFS
VFLGVDSPVRNYDNAKSQNAEAYTAFFHAMLDAGVNLPPSCFEAWFLSDAHDDEAFEVFR
AALPRAAQAAAQVISA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaacgccgaactgttctctgccgcccaggccgtcattcccggcggggttgat
tccccggtgcgggcttacggctcggtaggcggggttccgcgcttcatcgagaaggcccaa
ggcccgtggatctgggacgccgaaggcacgcgctacgtcgatctggtgtgcacctggggc
ccggctctgcttgggcatgcccgtcccgaggtcgtctctgcggttcaggaggccgcgtcg
aaggggctgtcctttggcgccccgacccgcaccgaaaccgaactagcggatgccatcatc
gagcggatggatccggtcgagaaggtgcgtttcgtctcgacaggcactgaggcgacaatg
actgcggtccgtttggcccgtggcgccaccggtcgtgacgtcatcgtcaagtttgccggt
aattaccacggccattctgacgccctgctcgccgccgccggttccggtgtagcgacggct
ggtctacccggttcggccggtgtgccagccgcctcgactgccgacactattgtggtggat
tacaacgacgtcgccgccctcgacgcggtgttctccgagcgtggcgaccagattgctgca
gtgatcgtggagtcctgcccggccaatatgggagttgttccgcccgagcccggcttcaat
gccgcgattcgtcgcctcacaaccgagcacggcgccctcatgatcaccgacgaagtactc
accggattccggtgcagcccgtcgggattctggggtttgcaacagcaggccggcgaggac
ttcgcgcccgacattttcaccttcggcaaggtcgtgggcggaggcatgccgctggctgcc
ctgggtgggcacgccgatgtcatggacttgctggctcctaccggccccgtctaccaggcc
ggcactttgtccggtaacccgctggccaccgtcgcgggtgtcaaaaccctacagctggcc
gacgccgaggtgtatcagcgcctcgatgtccgctccgagaaatggcgcaatgagctcgaa
tccgcacttgacgcagccggcgtcacgtaccgcctgcagaacgccggaaatctcttcagc
gtattcctcggcgtcgactccccggtgcgcaattacgacaacgccaagtctcagaatgcc
gaggcttacaccgcgttcttccacgcgatgctagatgccggggtcaacctgccgccatcg
tgctttgaggcctggttcctctcggacgctcacgacgacgaagctttcgaggttttccgc
gccgccctgccgagggctgcccaggcggctgcccaggtgatcagtgcctga

DBGET integrated database retrieval system