KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_06210Help
Entry
TIIST44_06210     CDS       T01972                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00860  Porphyrin and chlorophyll metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIIST44_06210
Enzymes [BR:pad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TIIST44_06210
Exosome [BR:pad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TIIST44_06210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMS28_porin
Motif
Other DBs
NCBI-ProteinID: AER05727
Position
complement(1344982..1346028)
Genome map
AA seq 348 aa AA seqDB search
MNPYLPDASDPRMAGVKPLPEGLRPVSRPRRLRTTPAMRRMVAETRVVPAQLILPAFVKG
GVDSPVEITSLPGQFQHSTESIKELATQAAEAGIGGIDLFGIPEHKDEIGSQAWDPKGIL
NAGISAVREAVGDDLVICADTCLDEFTEHGHCGALTPDGRVDNDSTVPLYAAMAVSQARA
GAHMVSPSGMMDGQIAVIRDALDREGFTDVSIMAYSAKYASAFFGPFRDAVDCSLKGDRK
AYQQDPSNRREGLRETLLDLAEGADLVMVKPASHYLDVLSDVAEVSQVPVAAYQVSGEYA
MLEAAAANGWIDRRRCIGESLTSIVRAGADLVLTYWAIEAAQMFREDL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtacctgcctgatgccagtgatccccgcatggctggggtcaagccattgccc
gaggggctgcgtcctgtttctcgtccgcgtcgactacgcaccactcctgcgatgcgccga
atggtcgccgaaacccgcgtcgtccccgcccagttgatactgccggcgttcgtcaagggg
ggggtcgattcccccgtcgagatcaccagcctgcccggccaatttcagcactccaccgag
tcgattaaagagctcgccacccaagctgccgaggccggtatcggtggtattgacctgttt
ggtatcccggaacataaagacgagatcggttctcaggcctgggacccgaaaggcatcctc
aacgccggcatctctgctgtgcgcgaggccgtcggcgacgatctggtgatctgtgccgac
acctgtctagacgagttcaccgaacatggacattgcggagctctgacccctgatggtcgc
gtcgataatgactccaccgtgccgctatatgccgcgatggcggtctcccaagcgcgcgcc
ggagcccacatggtctccccgtcggggatgatggacggtcagatcgctgtcattcgcgat
gctctggatcgcgagggattcaccgacgtgtccatcatggcctattcagctaagtacgct
tcagccttctttggccccttccgggacgccgtagactgttcccttaagggtgatcgcaaa
gcttaccagcaggatccatcgaaccgccgggaaggcctacgcgaaacccttctcgacctc
gccgagggagccgatctggtcatggtgaagcccgcctcccactacctcgacgtgttgtcc
gatgtcgccgaggtgtcgcaggtaccggttgccgcttaccaggtctctggagaatacgcc
atgctcgaggccgctgccgccaacggttggatcgatcgccgacggtgcatcggagagtcc
ctgacctcgatcgtgcgtgccggtgccgatctcgttttgacctactgggcaatcgaagcg
gcccagatgttccgcgaggacctctga

DBGET integrated database retrieval system