KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_06310Help
Entry
TIIST44_06310     CDS       T01972                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00860  Porphyrin and chlorophyll metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIIST44_06310
Enzymes [BR:pad01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     TIIST44_06310
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TIIST44_06310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AER05745
Position
1364990..1366705
Genome map
AA seq 571 aa AA seqDB search
MTDEAHQPTPQPAGDLGTASSQARVQFVGTGPGDPNLLTLGAVDAINRAQVIVISCAEHR
MLLGSDFLGLRPDVRIVLAGGVDEEAAVLPSQPGTGAPTPVDVDEHCADVTATVIDAASQ
GLEVVRLVSGDPFLDGDIGAEAAAVARADHDVDVVPGVTGMTAVPEYAGLILHGHDVQLI
GDAACQRDIAGHGSNWSDQGLIVVNTEAGKLKEVVKHAIESGRGEDEPAALICHGATTQQ
TTHTVTLGELPQTAKTARLGDAEPVHVAIGKVVEAPEREQLDWYESKPLFGWNILIPRTR
DHSATLPSRLQSYGAHSLDVPTISMEPPRTPQQMDKAIRGLVEGRYEWVVFTSANAVRAV
SEKLEQIGLDARAYSGLRIAAIFDSTINALAEWGVRPDFVPSGEQSTRALAAVFPAFDEA
LDPINRVFVPRADIATESLSADLSELGWEVEDVVGYRTVRAAPPPAETREAIKTGKFDAV
VFTSSTTVRNLVGIAGKPHKHTVVAAVGIRTAETCREHGLTVDVIAPEPTALSLADALAD
FAAKRRDDMVAKGLPVVRPSQRKRRGRHPSR
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgaggctcaccagccgacgccgcagccggccggtgatctgggcactgcgtcg
tctcaggccagggtgcagtttgtgggtaccggaccaggagatccgaatctgttgaccctt
ggagctgttgacgccatcaatcgcgctcaggtcatcgtcatttcgtgcgccgagcaccgc
atgctgctgggcagtgattttcttgggcttcgtcccgacgtcagaatcgtgttggcgggt
ggtgttgatgaagaagccgccgtcctacccagtcagccagggactggcgctccgactccc
gtcgacgtggacgagcactgcgctgacgtcactgccaccgttattgatgccgcctcccaa
ggccttgaagtcgttcgtctcgtttctggggatcctttccttgatggcgatattggcgcg
gaggctgccgctgtggctcgcgctgatcatgacgtcgacgttgttcccggtgtcactggc
atgaccgctgtcccggagtacgccgggctgatcttgcatggccatgacgtccagctcatc
ggggacgctgcatgtcagcgcgatattgctggacatggttcgaactggtcagatcagggg
ctcatcgtcgtcaatactgaggctggcaagcttaaagaagtcgtcaaacacgcgattgaa
tctggacgcggtgaggatgagcccgcggcccttatctgccatggcgcgacgacccagcag
accactcataccgtcaccctcggtgagttaccacagaccgctaagacagcgcgcctgggt
gacgctgagccggttcacgtcgccatcggcaaagttgtcgaagcccccgaacgtgagcag
ctcgattggtacgagtccaagccgttatttggctggaacattctcatcccgcgcacccgt
gaccattccgcgaccctgccctcacgactacagagttacggtgcccattcccttgatgtt
cccacgatttcgatggagcctccgcgtactcctcagcagatggataaagctattcgcggt
cttgttgagggacgttacgagtgggtcgtctttacttctgccaacgcggtacgtgccgtt
tcagagaagctagagcagatcggtctggacgctcgcgcgtactcaggcttgcggattgcc
gcgatcttcgactcgactatcaacgctttggctgaatggggtgttcgacccgatttcgtg
ccatcgggcgagcagtccacccgagctctggccgcggtattcccggcctttgacgaggcc
ctcgaccccattaaccgcgttttcgtgccgcgtgccgacatcgccactgagtccctgtcg
gccgacctatctgagctgggatgggaggtcgaagacgtcgtcgggtatcgcaccgtgcga
gctgccccgccgccagctgagacccgtgaagccattaagaccggcaaattcgacgccgtc
gtgtttacctcctcgacgactgtgcgcaacctcgtcggtattgccggaaaaccacataag
cacaccgtggtcgccgccgttggtatacgcactgctgaaacctgccgtgagcacggcctg
accgtcgacgtcatcgcccccgagccgactgcgttgagcttggctgacgccctggcagat
ttcgctgcgaagcgccgtgatgacatggttgccaagggcctgccggtagttcggccctcc
cagcgcaagcgtcgtggccgtcatccgtcacgctga

DBGET integrated database retrieval system