KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_08150Help
Entry
TIIST44_08150     CDS       T01972                                 

Definition
(GenBank) cysteine synthase/ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00998  Biosynthesis of secondary metabolites - other antibiotics
pad00999  Biosynthesis of secondary metabolites - unclassified
pad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    TIIST44_08150
   00999 Biosynthesis of secondary metabolites - unclassified
    TIIST44_08150
Enzymes [BR:pad01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     TIIST44_08150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: AER06094
Position
1727398..1728387
Genome map
AA seq 329 aa AA seqDB search
MTKYGEMLIIDAKLVETFLKGRESFLIDLVERVYRAHHAGNTVCPDSYFLRFPDAPRDRI
IALPSYINDQTCVSGIKWISSFPENVDHGLQRASAVIVLNNTDNGYAYAFIEASRISAAR
TAASAALAVRVLHGAPTSIGVVGSGPIAQTTLHFIKSLYTTAVPVKIHDLNSELVARIVT
RHGPECSVVSLEEALGCDLVLLATSAGTPYVPMSVRFQPNQLVLNISLRDLHPETIRTAN
NVFDDVEHCLKANTTPHLLEQLNGNRNFITGTLAEFICSEKQLDPDHPTVFSPFGLGILD
LAVAQSLYEHVQISGDGLRVPDFHGDMKR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaatatggtgaaatgctaattatagacgccaagcttgtcgaaacatttttaaaa
ggcagagagtcgtttctcatcgatcttgttgaacgtgtttatcgagcacatcacgctgga
aatacagtatgtcccgatagttattttcttcggtttccagatgctccacgagatcgtatc
atagcgttgccatcttatatcaatgatcaaacctgtgtgtcgggaattaaatggatttct
agctttcctgagaatgttgatcatgggctacaaagagcttcagcagtcatcgtgctaaat
aacacagataacggctatgcttatgcgttcatcgaggccagccgcattagtgcggctcgt
acagctgcctcggctgcgcttgcagttcgagttcttcacggtgctcctacgagtatcggt
gtagtaggcagtggccctatcgcacagacaactttacattttattaagtcgctatacacg
acagcggttccagtgaaaattcacgatttaaatagtgaattagtcgcacgtatagtcact
cgccacggccccgagtgttcggtagtcagtttagaagaagctcttggctgtgatctcgtg
ctattagccaccagcgccggaactccttatgtgccgatgagtgtacgtttccaaccgaac
cagctcgttctcaatatctcgcttcgtgatttacaccctgagaccattcgaacggctaat
aacgtgtttgatgatgttgaacattgcctgaaggcaaacactacaccccacctcctcgaa
caattgaacggaaatcgaaatttcatcacaggcacactggcggaattcatatgctctgag
aagcagcttgaccctgatcatccaaccgtattctctccttttggtttaggaattttggac
cttgctgttgctcaaagcttgtacgagcacgttcaaatatccggcgatggattacgtgtt
ccagactttcacggagacatgaaacggtga

DBGET integrated database retrieval system