KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_10100Help
Entry
TIIST44_10100     CDS       T01972                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00010  Glycolysis / Gluconeogenesis
pad00620  Pyruvate metabolism
pad00640  Propanoate metabolism
pad00680  Methane metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
pad01130  Biosynthesis of antibiotics
pad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_10100
   00620 Pyruvate metabolism
    TIIST44_10100
   00640 Propanoate metabolism
    TIIST44_10100
  Energy metabolism
   00680 Methane metabolism
    TIIST44_10100
Enzymes [BR:pad01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TIIST44_10100
Lipid biosynthesis proteins [BR:pad01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TIIST44_10100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AER06475
Position
complement(2139604..2139789)
Genome map
AA seq 61 aa AA seqDB search
MVGDGTCPITDTWWQTETGMFQITTVPSMPLKPGAAGRPVAVVDEEGNEVPAGKEGFLVP
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggtgacggcacgtgtccgatcaccgatacctggtggcagaccgaaactggcatg
ttccagatcaccactgtgccgtcgatgccgctcaaaccaggtgccgctgggcgtccggtt
gctgttgtcgacgaggagggcaatgaggtccctgcgggcaaagagggcttcctcgtcccc
aagtga

DBGET integrated database retrieval system