KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_10990Help
Entry
TIIST44_10990     CDS       T01972                                 

Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00020  Citrate cycle (TCA cycle)
pad00310  Lysine degradation
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
pad01130  Biosynthesis of antibiotics
pad01200  Carbon metabolism
Module
pad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIIST44_10990
  Amino acid metabolism
   00310 Lysine degradation
    TIIST44_10990
Enzymes [BR:pad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TIIST44_10990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AER06651
Position
2330206..2331576
Genome map
AA seq 456 aa AA seqDB search
MSTEVTLPALGESVTEGTVSRWLKAVGDTVEADEPLLEVSTDKVDTEVPSPASGTLLEIK
VPEDEDAEVGAVLAIIGDPSESGSAPAKPTAEPAEKAEPEPVKSEAEEAPAPAAPKPAEA
PKPAGTNEVAPRATNPSSDVYVTPLVRKLARENNVDLSTITGTGVGGRIRKQDVLAAAGK
SGEAPSAPQAPAAPAPAAPKPASSARKASQEVSPEAAALRGTTEKMSRLRKVIASRMVES
LQISAQLTATVEVDMTAISRIRNAEKAAFKAREGVGLSYLPFITKAVVEALKANPTFNAN
IDTEAGTITYGSSENIGIAVDTPRGLLVPVIKNAGDLNIAGLAHQIGDLAARTRDNKVTP
DELSGGTFTITNYGSAGALFDTPIVNQPEVAILGTGALVKRPVVVTNEFGEDTIAVRDMM
YLSLSYDHRLIDGAVAARFLSGIKARLEEGDFAGEF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcactcttcctgcactgggcgagtccgtcaccgaaggcaccgtgtcc
cgctggctcaaggctgtcggagacaccgtcgaggccgacgaacccttacttgaggtgtcc
accgacaaggtcgataccgaagtcccctcccccgcctccggcaccctacttgagatcaag
gtccccgaagacgaagacgccgaagtcggcgccgtcctagccatcatcggcgacccctcc
gagtcgggctctgcgcctgctaagccgacggctgagcccgcagaaaaggccgagcctgag
ccggtgaagagcgaggccgaggaggcccctgcgccggccgcgccgaagcccgccgaggct
cccaaacccgccgggaccaatgaggtcgccccacgcgccaccaacccatcgtcggacgtc
tacgtcaccccgctagtccgcaagctcgcccgggagaacaacgtcgacctgtcgacgatc
accggaactggtgtcgggggtcgtattcgcaagcaagacgtactagctgcagccggtaag
tctggagaggctccctcagctcctcaggcaccggctgcccctgccccggctgctccgaaa
ccggctagttcagcccgtaaggcctcccaggaagtctctccggaggctgccgctctgcgc
ggcaccaccgaaaagatgagccgtctacgcaaagtcatcgcctcgcggatggttgagtcc
ctacagatctcggctcagttgacggccaccgtcgaagtggacatgaccgctatctcccgc
atccgcaacgctgagaaggctgctttcaaggctcgcgagggagtcggtctgtcctacctg
cctttcattactaaggccgtcgttgaggccctcaaggccaatccgaccttcaacgcaaat
atcgacaccgaggcggggacgatcacctacggttcttctgagaacatcggcatcgccgtt
gataccccgcgcgggctgctggttccggtcatcaagaacgccggtgatctcaatatcgct
gggttggcccaccagattggcgatctcgctgcccgcacccgcgacaacaaggtaacccct
gacgagctgtccggcggcaccttcaccatcaccaactatggctcggccggtgccctcttc
gacaccccgatcgtcaaccagcccgaggtcgccatcctcggcaccggtgctctggttaag
cgcccagtcgtcgtcaccaacgagttcggcgaggataccatcgcagtccgcgacatgatg
tacctctcgctgtcctacgaccaccggctcattgacggcgccgtggcggctcgcttccta
tcgggcatcaaggctcgtctggaagagggcgacttcgccggagagttctga

DBGET integrated database retrieval system