KEGG   Pygoscelis adeliae (Adelie penguin): 103912845Help
Entry
103912845         CDS       T06012                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl00564  Glycerophospholipid metabolism
padl00565  Ether lipid metabolism
padl00590  Arachidonic acid metabolism
padl00591  Linoleic acid metabolism
padl00592  alpha-Linolenic acid metabolism
padl01100  Metabolic pathways
padl04010  MAPK signaling pathway
padl04217  Necroptosis
padl04270  Vascular smooth muscle contraction
padl04370  VEGF signaling pathway
padl04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:padl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103912845
   00565 Ether lipid metabolism
    103912845
   00590 Arachidonic acid metabolism
    103912845
   00591 Linoleic acid metabolism
    103912845
   00592 alpha-Linolenic acid metabolism
    103912845
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103912845
   04370 VEGF signaling pathway
    103912845
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103912845
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103912845
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103912845
Enzymes [BR:padl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103912845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 DOCK-C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 103912845
NCBI-ProteinID: XP_009317527
Position
Unknown
AA seq 822 aa AA seqDB search
MGLFYSKSQTEPSPCNLLTVKIIRMKNARKADLLTQSDCYVSLSLPTASVQHFRTKTVQN
SKNPTWNETFHFTIQSQVKNILELKVCDEDNITQDDHLLTVFFDVSKIQLGENIQLCFQL
NPQGKEELEVEFTMESSPDPPENIVTNGVLVSREVSCLEVQVNDGRLRKNSTERKFALTV
DGSYEGTQTHTLSSCLCPTSPARFHYIKYNQSALTVALPRRRRLSRSLSSQNERDMNESV
TLALNSLPIQEKITIAEDRTIDLYTKANEWTQGLCFRPRNLDARLGFDLCTDEQDFLQNR
RKVVAAALKDVLHLEEDLQEHEVPIVAVTTAGCGIRALTAMYGSILGLQKLRVLDCVSYI
SGSSGTTWTMTKLYEDADWSRKDLGEVIIEARKQAAKCKMGAFCLRSLRNYYRELSQRTQ
AGHKTSFIDLWGLMIESMLNDGKCHHRLSDQRRAVNQGQNPLPIYLALNVKDKIATKDFR
EWVEFTPYEVGFLKYGAFIRAEDFGSEFFMGRLMKKLPESRICFMQGMWSSIFSKNLLDA
WHAADNSEDFWHRWTQDKVAEIEEQPDLPEKPYEMATCMFTPTSGLSTALRDILTDRPAV
SKYHNFLRGFQMHNEYIQQEHFTKWKDTLLDTSPNDLRGKSEHLELVDAAFFFETSCPPL
MRPERKVDVIIHLNYTGGSQTLPLEQACRYFSEQGIPFPSIGLKDDEKNLKECYMFDGAD
TPGAPLLLYFPLVNDTFQRYVAPGMSRSAAEMEQGKVDISSFCSPYSTREVSLKAEDFNK
LLKLTNYNIMNNENMILQALRMTVARKKQAPSQPVSQAQSPA
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggggctgttctacagtaagagccagacagaaccctctccatgcaacttgctcactgta
aaaatcatacggatgaaaaatgccaggaaagcagacttgttaacccagtccgactgctac
gtgagcctgagcctgccaacagcttcagtgcagcatttccgcaccaagacagtccagaac
agcaagaacccgacgtggaacgaaaccttccacttcacaattcagagccaggttaagaac
attctggagctaaaagtttgtgatgaggacaacataactcaagatgaccatctcctcact
gttttctttgatgtctccaaaatccagcttggagaaaacattcagctatgtttccagctg
aatccacagggaaaagaggagctggaggttgaattcacaatggagagcagtccggatcct
cctgaaaacattgttactaatggagttttagtgtcccgtgaggtttcgtgtttggaggtg
caggtgaatgacgggaggctgaggaagaacagtacggagagaaagtttgcattaactgtg
gacgggtcgtacgaaggaacccagacccacacgctgagctcctgcctctgcccgacctcc
ccggccaggttccactacatcaaatataatcagtcggcactcactgtggctctaccgcgg
cggaggcggctcagcaggtctctatcaagtcaaaatgaaagggatatgaacgagtctgtg
actctagctctgaactcgcttcctatacaagagaaaataacaatagcagaggacaggaca
attgacttgtacacaaaggcaaatgaatggactcagggtctgtgtttcaggccaagaaac
ctagacgcccgcctggggtttgacctgtgcaccgacgaacaggatttcctgcaaaaccgg
aggaaggtggttgctgctgcgctgaaggatgttcttcatctggaggaagatctgcaagag
catgaggtgcctatagtggctgtgaccacagcaggatgtgggataagagcactcactgcc
atgtatggcagcattttgggtcttcaaaagttgcgtgttctggactgcgtttcatacatc
agtggctcgtctggcacaacgtggactatgacaaaactgtatgaagatgctgattggtca
cgtaaggatcttggagaagtaattatcgaagctcggaagcaagcagccaagtgcaagatg
ggggctttctgcttgagaagtctgaggaattattacagagagctgagccaaaggacccaa
gcaggacataagacatcttttattgatctgtgggggctcatgattgaatccatgctaaat
gatgggaaatgccaccacagactctctgatcaacgtcgggcagtgaatcagggtcagaac
ccgctgcccatctaccttgccctcaatgtcaaggacaaaattgccaccaaagattttaga
gagtgggtggagttcacaccctacgaggtgggcttcctgaagtacggcgccttcattcgc
gcagaggattttggcagcgagttcttcatgggtcgcctgatgaagaagctccctgagtcc
cggatctgcttcatgcaaggaatgtggagcagtatcttctccaaaaacctcttggatgcc
tggcatgcagctgacaattcagaggacttctggcacaggtggacccaagacaaagtggct
gaaatagaggaacaaccagacttgcccgagaagccatacgagatggctacatgcatgttc
actcctacgagcggcctctccacggctctccgggatatcctgacggaccgccctgccgtc
tccaagtaccacaacttcctgaggggcttccagatgcacaacgagtacatccagcaggag
catttcacaaaatggaaagacactttgctagacacctctcctaatgacctcagaggcaaa
tcagagcacctggagttggtggatgcagctttcttctttgaaaccagctgcccacccctt
atgagaccagagcggaaagtggatgtcatcatacacttaaattacaccggtggatcacag
accttgcccctggagcaggcttgcagatatttctcggagcaaggaattccgtttcccagc
attgggctgaaggatgatgagaagaacctgaaagagtgctacatgttcgacggtgcagac
accccaggagctccgctgctgctttattttccattagtgaatgacaccttccaaagatat
gtagcacctggcatgtcacgtagtgctgccgaaatggaacagggcaaggttgatatctcc
agtttctgctctccatactcaacgagggaggtctcgctgaaagcagaagatttcaacaag
ctcctgaagctgactaattacaacataatgaacaacgagaacatgattcttcaggccttg
cgcatgactgtggcacggaagaaacaagccccgagccagccagtatcacaagcacagtcc
cctgcttga

DBGET integrated database retrieval system