KEGG   Pygoscelis adeliae (Adelie penguin): 103914061Help
Entry
103914061         CDS       T06012                                 

Gene name
TYW3
Definition
(RefSeq) tRNA wybutosine-synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Brite
KEGG Orthology (KO) [BR:padl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:padl03016]
    103914061 (TYW3)
Enzymes [BR:padl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     103914061 (TYW3)
Transfer RNA biogenesis [BR:padl03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    103914061 (TYW3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 RRXRR
Motif
Other DBs
NCBI-GeneID: 103914061
NCBI-ProteinID: XP_009318945
Position
Unknown
AA seq 243 aa AA seqDB search
MVEFRTWEEGAGQAAGPQPVGQEGWLCPFRESHGIPESPAGDINSCEIQKKNCTWLMVTH
EMCVKDDVMTALGKATGDVVLKFEPFVLHVLCQELQDAQLLHSVAIDSGFRNSGITVGRG
GKIMMAVRSTHCLEVPLSHKGKLMVSEEYIEFLIHVANRKMEENTRRIDRFYKCLELALK
AAVSANNSPSEETEKNRSVYIHRRKRKTIQEQDVHTSPKDHNEELEPEDDTESNLDIFAE
IVI
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggtggagttcaggacctgggaggagggagcagggcaagcagcaggaccacagcctgtc
ggtcaggagggctggctctgccccttcagggaatcccacgggattccggagagccccgcg
ggggatataaacagctgtgagatccagaagaaaaactgcacatggctcatggtaacacat
gaaatgtgtgtcaaagacgatgtgatgacagcactagggaaagccactggtgacgttgtg
ctcaagtttgagccatttgttcttcatgtgctatgtcaagagctgcaagatgcacagctt
ctgcattcagtggctattgattctgggttcaggaactctggtattaccgttggcagagga
ggaaaaatcatgatggctgtccggagcactcattgcttagaagttccattgagccacaag
gggaaattgatggtctccgaagaatatattgaatttctgatacatgtagctaatcgaaaa
atggaagaaaacacaaggaggattgacagattctacaaatgcttagagttagctttgaaa
gctgctgtcagtgcaaacaactcgccttctgaggagacggagaagaatcgctctgtgtac
attcacaggagaaagagaaagaccatccaagaacaagatgtacacacctctccaaaggat
cacaatgaagaattggagcctgaggatgatacagaaagcaatcttgatatttttgctgaa
atcgtgatatag

DBGET integrated database retrieval system