KEGG   Pygoscelis adeliae (Adelie penguin): 103914240Help
Entry
103914240         CDS       T06012                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103914240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:padl04030]
    103914240
G protein-coupled receptors [BR:padl04030]
 Rhodopsin family
  Lipid
   Leukotriene
    103914240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 103914240
NCBI-ProteinID: XP_009319129
Position
Unknown
AA seq 336 aa AA seqDB search
MSQAEESSIHSTWNIVRSVVCIILSLSFIIGTPGNCIVIWTVCTKMKQVSPSVLLILNLA
IADVLVLITLPVWIYSFADSWVFGVIFCKILVFIIYCSMYASIFLITALSLERLMAVFYP
FTIQKYKTKEKISLIVFLIWFLSITFGVSVIPFQETEEMNGGLLCTCRNYSSNRQKVSYL
LLETLAGFVIPFLIICTCYMCVARRISRMTYQTKQRSERLIASIVVAFILCWFPHHLFNI
LDIISIQIELSNEEMSLALDEIVGRGAYISGALVFISSCINPLLYAFAARRFQNHLRFAK
ILKLFEQMSQTVTDEDKKKSLVVTKQEDTLVSTENL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagctgaagaaagcagtatccactcgacgtggaatattgtgaggtcagtggtc
tgcataatactgagcttgtcatttattattgggaccccaggaaattgcatcgtcatctgg
actgtgtgtacaaaaatgaagcaagtatctccttcagtcctgctgatcttgaacctggcc
attgcagatgtccttgtactgattactttaccggtttggatttactcctttgctgactca
tgggtttttggagtcatcttctgcaaaatactagttttcattatttactgcagcatgtat
gctagtatatttctaattacagcactgagcttggagcggttaatggctgtgttttaccct
ttcacaattcaaaaatacaaaacaaaagaaaagatttctttaatcgtgttcctcatttgg
ttcctgtctattacttttggcgtttctgtcattccatttcaagagacagaagaaatgaac
ggtggactactatgcacatgtcgcaactactcttctaatagacagaaagtgtcatatctt
ttgctggagactcttgcaggttttgtaatcccttttttaattatttgcacttgttacatg
tgtgttgcaagaagaataagcagaatgacttaccaaaccaagcagcgatcagaacggctc
attgccagtattgtggtggcattcattttatgctggttccctcatcatctctttaacatc
ctagatattatttcaattcagatagaactctctaatgaggaaatgtctttggcactggat
gaaattgtaggcagaggagcgtacatctctggagctcttgtattcatcagtagctgtatt
aaccctctactttatgcttttgctgcacgaagatttcaaaatcacctgagatttgccaag
atattaaagctttttgaacagatgagtcagactgtaacagacgaagacaagaaaaaaagt
ttggttgtaaccaaacaagaagatactttagtaagcacagaaaatctctaa

DBGET integrated database retrieval system