KEGG   Pygoscelis adeliae (Adelie penguin): 103914891
Entry
103914891         CDS       T06012                                 

Gene name
ASIC4
Definition
(RefSeq) LOW QUALITY PROTEIN: acid-sensing ion channel 4
  KO
K04829  acid-sensing ion channel 1
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Brite
KEGG Orthology (KO) [BR:padl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:padl04040]
    103914891 (ASIC4)
Ion channels [BR:padl04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   103914891 (ASIC4)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 103914891
NCBI-ProteinID: XP_009319891
Position
Unknown
AA seq 457 aa
MMDLKVDEEEEDSGQPVSIQAFASSSTLHGLSHIFSYERLSLKRVVWALCFLGSLALLTL
VCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQC
TPEDFKVVYTRYGKCYTFNGDRRNPRVNRQGGMGHGXIMRDIQQEEYLPIWRETNETSFE
AGIRVQIHSQDEPPYIHQLGFGVSPGFQTFVSCQEQRLIYLPPPWGDCKAVAGDSEFYDT
YSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCE
MPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKK
AYEVAGLLGDIGGQMGLFIGASILTILEILDYVYEVR
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgatggacctgaaggtggacgaggaggaggaggacagcgggcagccggtgagcatccag
gccttcgccagcagctccaccctccacgggctctcgcacatcttctcgtacgagcggctg
tcgctgaagcgcgtggtctgggctctgtgcttcctgggctcgctggcgctgctcaccctc
gtctgcaccaaccgcatccagtactacttcctctacccccacgtcaccaagctggacgag
gtggcggccaccaggctcaccttccccgccgtcaccttctgcaacctcaacgagtttcgt
ttcagccgggtgaccaagaacgacctgtaccacgccggcgagctcctcgccctgctcaat
aacagatatgagatcccagacacccagaccgccgacgaaaagcagctggaaatcctgcag
gacaaggcgaacttccgaaacttcaagcccaaaccttttaacatgctggagttttatgac
cgggctggccacgacatccgggagatgctgctgtcctgcttcttccgtggggagcaatgc
acccccgaagacttcaaagtggtctacacgcgctatggtaagtgctataccttcaatggg
gaccggaggaacccgcgcgtgaaccgccaaggcggcatgggccacgggnagatcatgcgg
gacatccagcaggaagagtacctgcccatctggagagagaccaatgagacgtcattcgaa
gctggcatccgggtccagatccacagccaggacgagccgccctacatccatcagctgggc
tttggcgtctcgcccggcttccagaccttcgtgtcctgccaggagcagcggctcatctac
ctgccgcctccctggggcgactgcaaggccgtggcgggcgactcggagttttacgacacc
tacagcatcactgcctgccgcatcgactgtgagacccgctacctggtggagaactgcaac
tgccgcatggtgcacatgccgggcgatgcaccttactgcaccccagagcagtacaaggag
tgcgcggatccagccttagatttcctggtggagaaggacaacgagtactgcgtctgcgag
atgccctgcaacgtgacccgctacggcaaagagctctccatggtgaagatccccagcaag
gcctccgccaagtacctggccaagaagtacaacaagtcggagcagtacattggggagaac
atcctggtgctggatatcttctttgaagccctgaactacgagacaatcgagcagaagaag
gcatacgaggtggccggcttgctgggggacatcgggggacaaatgggcctgttcatcggt
gccagcatcctcaccatcctggagatcctggactatgtctacgaggtgcgctga

DBGET integrated database retrieval system