KEGG   Pygoscelis adeliae (Adelie penguin): 103915830
Entry
103915830         CDS       T06012                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl00230  Purine metabolism
padl00240  Pyrimidine metabolism
padl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:padl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103915830
   00240 Pyrimidine metabolism
    103915830
Enzymes [BR:padl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103915830
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 103915830
NCBI-ProteinID: XP_009321033
Position
Unknown
AA seq 290 aa
MQIKSVSGTVLRLPGVPCASNTAATLPTASPRNLTTAAIFISKTSLTYTLGELLKPSPAA
GKSTFVRLLEKHSDEWEIIPEPIAKWCNIQTAEDEYEELSTSQKSGGNLLQMLYDKPTRW
AYTFQTYACLSRVRAQLKPVSAKLHEAEHPVQFFERSVYSDRYVFASNLFESGNINETEW
AIYQDWHTWLLNQFESDIELDGMIYLRTTPQKCMERLQMRGREEEQGIELEYLENLHYKH
ETWLHERTMRVDFENLKEIPILVLDVNEDFKNDKIKQEYLIDKVKSFLTS
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcaaatcaaatcagtaagtggaaccgttttacgcctgcctggggtcccgtgcgcctca
aacaccgcagcgacgctgcctacggcctctccaagaaacctcacaactgccgctatcttt
atcagtaagaccagcctaacctacaccctcggtgaacttctcaaaccttctccagctgca
gggaagtcaacatttgtcaggctgctagagaaacacagcgatgagtgggagatcatccct
gaacccatcgccaagtggtgcaacatccagacagctgaagatgaatacgaggaactttca
acatctcagaagagcggaggaaatctacttcaaatgctgtatgataaacccacgagatgg
gcttatacatttcagacttatgcttgcttgagccgagtaagagcgcaattaaaacctgtc
tcagccaagctacatgaagcagaacatccagtgcaattttttgagagatctgtgtacagt
gacagatatgtatttgcttctaacctgttcgagtctggaaacattaatgaaacagagtgg
gccatttatcaggactggcacacatggcttttgaatcagtttgaatcagatatagaacta
gatggcatgatctacctaagaaccacacctcagaaatgcatggaaaggctacagatgagg
ggaagagaagaagagcaaggaattgagcttgaatatttggaaaacctccactataaacac
gaaacctggcttcatgaaaggactatgagagttgatttcgagaaccttaaggagattccc
attctagttttggatgttaatgaagattttaagaatgataagattaaacaggagtacctg
attgataaggtcaagtctttcctgacttcttaa

DBGET integrated database retrieval system