KEGG   Pygoscelis adeliae (Adelie penguin): 103917738
Entry
103917738         CDS       T06012                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Brite
KEGG Orthology (KO) [BR:padl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:padl03000]
    103917738 (AHRR)
Transcription factors [BR:padl03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    103917738 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 103917738
NCBI-ProteinID: XP_009323203
Position
Unknown
AA seq 759 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQTIKEDNVSNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQTETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKADDAAAVNTN
SSSKGNSGLCEAAELYGRNSHHEGAAFTNVLQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKIPSSFASLKGNLEGLSYNSAIETLGQ
WKHLNWTAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSVLGIQNNCTTNGGWTLRNSS
SCSMSQRMNTCSNRRAGSFYNRDQSFLNLASTCPSHWGSAESCQPYSDVQQRCAENYATD
HLKLQRQLISSESLYDAACPLEMPIKTEYDSDSENIADNYLTSQNRAWLDENGSVRKQVF
SYPNRVHLKTEPDLCEPASPCQKPRHCLYTPHNWQCIVANHPNNLNLNRSCKGSRSKEVA
PFCPQNSSGCWESMPDLPHTACYGHFYSPSPGEEKEQNNEVFKMPCEFKNPCLVQAIKRE
PLDSPPLSNSGQNRVHVSFPENTLAGPVPHKTTECTFLQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctatatgctgggaggaaaaggaggaaacccattcagaaa
caaaggcctgcagtcgggaatgaaaaatcaaatccttcgaagagacacagggaccgtctg
aacgcggaactggaccatctggccagcctcctgccttttccacctgacatcatatcgaag
ctggacaaactgtctgtcttgcgccttagtgtcagctatctcagagtcaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaagttggccaaacaataaaagaagacaat
gtatctaacaagactgctgtacaagagggtggacttctactagagtcactgaacggtttt
gcgttggtggtgagtgcagatggaatgatattttatgcatcatcgacgattgtggattat
ctagggtttcatcagactgatgtaatgcaccaaaatatatatgattacattcacgtggat
gatcgccaggatttctgtagacaactgcactgggccatgaatcctccccagatgttgtct
ggacagcaactacagacagaaacaggagaagaatatattctcagtaaattgtttaaagca
caagagaatgacagcatgacaacagattattcttccttcttaactcgttgtttcatctgt
cgagttcgctgcttgttggacagtacttctggcttccttacaatgcagttccaaggcaaa
ctaaagtttctttttggacaaaggaagaagtcctcttcaggaacagtattgccacctcag
ctgtctttattttgcatagtggtaccacttctgctcccttccgtgacagagatgaagatg
aaaagcctgcttgtgaaagcaaaacacaaagctgatgatgcagcagcagtgaatacaaac
tccagttccaaaggtaattcagggctgtgtgaagcagcagaattatatggaagaaacagt
catcatgaaggtgctgctttcactaatgtgttacagattgctgaaaaccaaatcaaagca
aagaataatggagaaaacggcatttctctagtcaaagtacaaacaaacgaagatcactgg
gtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgtcctt
gcccaacagcaaatgttaaaggaagaagacgaacaactgaagataccaagcagttttgcc
agtttgaaaggaaacctggagggactttcctataacagtgctattgaaactctgggccag
tggaagcatcttaactggacagcagtaaaaaacgaacaagataatgtaaaagtgaagttt
gagcctcatacaaacggtgagtgttttatgcaagaggaacctctcagttctaacacatca
gttttaggcattcagaacaactgcaccacaaacggtggctggactttaagaaactcaagc
tcttgttctatgagccagcgaatgaacacatgttcaaacaggagagctggatcattctac
aacagagaccaaagtttcttaaatttagcatcaacttgcccttcccactgggggagtgca
gaaagctgccagccttactcggacgtacaacaacgctgtgcagagaactatgcgacggac
catctgaaactgcagagacagttaatatcctcagagtctctctatgacgcagcctgtccc
ttggagatgcctatcaaaacagaatatgattccgattccgaaaacattgctgataactac
ctgacatcgcaaaaccgagcctggctggatgagaatggctcggtgagaaagcaggtgttt
agctaccccaatagagtgcacctcaaaacagaaccggacctctgtgagccagcctcacct
tgtcagaagccaaggcactgcctttacacacctcacaattggcaatgcattgtagcaaat
catcccaacaacctgaacctgaacagatcttgcaagggttctcgtagcaaggaggtggcc
ccattttgccctcagaactcctccgggtgttgggaaagcatgcctgacctgccgcacacg
gcgtgctacggccacttctacagccccagcccaggggaggagaaagagcagaataatgag
gtgtttaaaatgccgtgtgaatttaaaaacccctgcttggttcaagcaatcaagcgtgag
cccctggattctccaccattgtccaacagtggacagaacagagtacacgtgagcttccct
gaaaatacattagcaggtcctgtgcctcataaaaccactgaatgtacatttttacaataa

DBGET integrated database retrieval system