KEGG   Pygoscelis adeliae (Adelie penguin): 103917858Help
Entry
103917858         CDS       T06012                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl00230  Purine metabolism
padl01100  Metabolic pathways
padl04270  Vascular smooth muscle contraction
padl04540  Gap junction
Brite
KEGG Orthology (KO) [BR:padl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103917858
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103917858
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103917858
Enzymes [BR:padl01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     103917858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 103917858
NCBI-ProteinID: XP_009323331
Position
Unknown
AA seq 685 aa AA seqDB search
MLRTLGGNLYEFIENLDALHSYLSLSYQEMNAPSFRVEKNEDGSMHLHYYSDRRGLCHIV
PGIIGAAALDFFNIEISMEIVDQTEEEERTGKKEHIVFLVTQNPVFSYKERNEFSSSPQY
LADSEKQIENQLNKEDLEKAKNTIRDRGSSVCPVKKSHWKTIRGIITLGKGKLLRGFDPV
YPKSLWIDTKTFCNGLPFHMVFDKELRVKQAGVSIQKIVPGLQTTGISLDHYFSILHPEV
PFTISSIQKFINSQFVFQTRREMMPESWKQRPMLELRGQMIWMESLQCMLYLCSPLLRTL
HELEERQMHIADIAPHDVTRDLILLNQQRLAEMELSNQLERKKEELRVLSKHLEEEKKKT
EALLYAMLPQHVANQLKEGKRVEAGEFKECTILFSDVVTFTNICAQCEPIQIVLMLNSMY
LRFDRLTTVHDVYKVETIGDAYMVVGGVPVPVPTHAERVANFALGMIIAAKGVQNPVSGN
PIQIRVGIHTGPVLAGVVGEKMPRYCLFGDTVNIASRMESHGVPSKIHLSSSAYQCLKYK
NFEMTGRGEIEVKGKGKMHTYFLIRNKTATENEIMGRPMKDLDSGHESVQSFQEVTQTQP
EKDQSPAIAMKYIDGPTDAQNSLKRRNQAKIADLTGKTYDSKSDGSLHGNQQADDGPCPL
NRGRVIPATEEAQIRNVRSNFCTLL
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggacactgggtggaaatctctacgagttcatagagaacctggatgcattgcac
agctacctgtccctttcttaccaggagatgaatgcaccatcttttagagtagaaaagaat
gaagacgggtcaatgcatttacattactattcagacagaagaggtctgtgccatattgtg
ccaggaatcatcggtgcagcagccctggatttttttaacattgagatttcaatggaaata
gtcgatcaaacagaagaagaagaaagaactgggaaaaaagaacatattgtttttcttgtc
actcaaaaccctgtattttcatacaaggaaagaaatgaattttcttcctcacctcagtat
cttgctgactctgaaaaacaaattgagaaccaactgaataaagaggaccttgaaaaagcc
aagaatacaattagagacagaggaagctctgtttgtcctgtcaagaaaagtcactggaaa
acaataagaggaataatcacgttaggaaaaggtaagctcctgagaggatttgatcctgtt
tatcccaagagcctctggatcgacacaaaaacattttgcaatggacttccttttcatatg
gtttttgacaaagagctcagagtgaagcaagctggggtgagcattcaaaagatcgtacct
ggccttcagaccacgggcatcagcttggatcactatttcagtatccttcacccagaagta
cccttcaccatctctagcattcagaaattcatcaacagccaatttgttttccagactaga
agagagatgatgccagagtcgtggaaacaacggccaatgctagagctgagaggccagatg
atctggatggagtccctgcagtgcatgctctatctctgctcacctttgcttcgcaccttg
catgaactggaggagcgacagatgcacattgcagacattgcacctcacgacgtgaccagg
gatttgattcttctcaatcagcagcgactggcagagatggagctctctaaccagctggag
aggaagaaggaagaactgcgggtactgtcgaagcacctggaggaagagaagaaaaagact
gaagctctgctctacgccatgcttcctcagcacgtggccaaccagctgaaagaggggaag
cgagtcgaggcaggagagttcaaggagtgcactatattgttcagcgatgttgtgaccttt
accaacatttgtgcccaatgtgagcctattcagatagttctcatgttaaattcaatgtac
ctgcgatttgacagactgaccacggtgcatgatgtgtacaaggtggagacaattggagat
gcctatatggtagtaggtggggtccctgtgcctgtacccactcatgctgagcgagttgct
aactttgccttggggatgataatagcagctaaaggagtgcagaacccagtttctggaaat
cctatccaaattagagttgggatccatacaggtcctgtcttggctggagttgttggagaa
aagatgcctcgttattgcttgtttggagacacggtgaatatagcttcccggatggagagt
cacggtgtcccgagtaaaattcatctaagctccagtgcctatcagtgcctaaaatacaag
aattttgagatgactggaagaggagaaatagaagtaaaaggcaaagggaaaatgcacaca
tacttcctcattagaaataagactgcaactgagaatgagattatgggaaggccaatgaaa
gacttggattcgggccatgaatctgttcagtcctttcaagaagttactcagactcagcca
gagaaggaccagagcccggccattgcaatgaagtatattgatggccccacagatgcacaa
aacagcctcaaaagaagaaatcaagcaaaaattgcggatttaacaggcaaaacttatgat
tccaaaagcgatggcagtctccatggcaaccagcaggcagatgatggtccttgtcctcta
aaccggggaagagtcatacctgctactgaagaggcacagattaggaacgttcgctctaat
ttttgcactttactctaa

DBGET integrated database retrieval system