KEGG   Pygoscelis adeliae (Adelie penguin): 103918744
Entry
103918744         CDS       T06012                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Brite
KEGG Orthology (KO) [BR:padl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:padl01002]
    103918744 (ERAP1)
Enzymes [BR:padl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     103918744 (ERAP1)
Peptidases and inhibitors [BR:padl01002]
 Metallo peptidases
  Family M1
   103918744 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Peptidase_MA_2 DUF1759
Other DBs
NCBI-GeneID: 103918744
NCBI-ProteinID: XP_009324414
Position
Unknown
AA seq 1062 aa
MPSWMMEASPLGEGNTFLFKEKPLHFLGRLMGHLTLSCAETDQEISCGAVEALRAFHRFI
LVRQSRLAAREDPKLRVERESASTLWPKGPADEATVTSASLALGVLAVGLAGDSDEPVRQ
PSGGTHGLPPIELRGPTTSPQGVAKGFSPASAQQLRPSWPPIFGSCLLPTERRDFLLTVL
RSMAHPRVSDTQPIANMLEVALRGSCSELTELVEDSSRAEDYLHQSLPYLQSPLEPLREA
AVRFIGLVGRQLRDGGQEKLQVIYDALSIQYFANLSESFHGFYKSIYRTQEGELRVLAAT
QFEPTAARMAFPCFDEPAFKARFSITIRREPKHLALSNMPVVKSVTITPCLVEDHFDTTV
KMSTYLVAFIVSDFKSISKITSHGVKISVYTVPDKINQAHYALDAAVKLLDFYEDYFSIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLYDPEKSSASSKLWVTMTIAHELAHQWF
GNLVTMEWWDDLWLNEGFAMFMEFVSVSVTHPELRVEDYFLRRCFDAIEVDSLNSSHPIS
TPVEDPAQILEMFDNVSYKKGSCILNMLRDYLTADVLKAGLVQYLQKYSYQNTKNEDLWN
IMTNICPTVGSDKNELQGDGFCRSQQSSSNAHWTKGETLDVRAMMDTWTLQKGFPLVTVT
VRGKNVHLQQERYMKGVNSPSSTGYLWHIPLTYITSKSDTVQRFLMTTKADVIILPEEVE
WVKFNVDMNGYYIVHYEDDGWDRLINVLKENHTMISSNDRASLINNVFQLVSINKLSISK
AFDLTLYLKHERQIMPVLQGMNELIPIYRLMERRDMDGTAKQLKEYIINLFKDLIDRQSW
SDEGSASERLLRHSLLLFACVHRYQPCVDKAKGYFTEWQKSNGTLSLPADVKTAVYAVGA
QTSEGWDFLLSKYRLQLFNVERENIELALSLSRSKDKLQWLMDQGLRGDIVRTQDLPHII
VFVAKTPSGCHLAWTFLKENWEKVVEKFELGSNSVATIVTGVTSRYSTRSQLAQVKEFFS
SLEEKSARLRCVQQAVETIEDNIQWMDRNFEKVKTWLQNNQL
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgccctcttggatgatggaggcctcgcccttgggagaaggcaacaccttcctcttcaaa
gagaagcctctccacttcctggggcggctgatggggcacctcaccctgtcctgtgccgag
acggaccaggagatcagctgcggggctgtggaggcgctgcgtgccttccacaggttcatc
ctggtgcgacagagccgcctggcagcacgtgaggatccaaagctacgagtggagcgggaa
agcgctagcaccctctggcccaaggggcctgctgacgaggcaacggtaacgagcgcctcc
cttgctctgggggtcttggccgtggggctggcgggagactcggatgaaccagtgcgtcag
ccatcgggggggacgcacggcctcccgccgatcgagctgcggggtcccaccacctctccg
cagggagtagccaaaggctttagcccagcgtcagcgcagcagctccggccatcctggcca
ccgatatttgggagctgcctcctccccacggagaggcgcgacttcctcctcacggtcttg
aggagcatggcgcacccgagggtctctgacacccagccgattgccaacatgctggaggtg
gccttgagaggctcgtgctcagagcttaccgagcttgtggaggacagcagcagagcagag
gactacctgcaccagagcctgccgtacctgcagagcccactggagcccctgcgcgaggca
gccgtcaggttcattgggctcgtcgggcggcagctgagggacgggggccaggagaagctc
caggtcatctacgacgctctcagcatccagtactttgcaaatctctccgagtccttccat
ggtttttataaaagcatctacaggacccaggaaggagaactcagagtgcttgcagcaaca
cagtttgagccgacagccgcgcgaatggccttcccatgtttcgacgaacccgccttcaaa
gccaggttttcaattaccattaggagggaaccaaagcaccttgcgctgtccaatatgcca
gttgtgaagtctgtgactataacaccctgccttgttgaggaccattttgataccaccgtc
aagatgagtacataccttgtggcctttatcgtttcggattttaaatccatcagcaaaata
accagtcatggagttaagatttctgtgtacacagtgccagacaagatcaaccaagctcat
tatgcgttggatgcggcagtgaaacttctagacttctacgaggattacttcagcattcca
tatcctctacctaaacaagatttggcagctattcccgattttcagtctggtgctatggaa
aactggggactgaccacataccgggaatctgcattgttgtatgaccctgagaagtcctca
gcatcttctaaactttgggttactatgacaatagcccatgagctggctcatcagtggttt
ggcaacctcgttaccatggagtggtgggatgatctgtggttaaatgaagggtttgcaatg
ttcatggagttcgtgtcagtcagcgttacccatccagaactgagagttgaagactatttc
ttaaggagatgttttgatgccattgaagtggattcattaaattcatcacatcctatatct
actcctgtggaagatccagctcaaattttagaaatgtttgataatgtttcttataagaag
ggatcttgtatattaaatatgctgagggactacctgactgctgatgtgttgaaagctgga
cttgtgcagtacctgcagaaatacagctatcagaatacaaaaaatgaagatttgtggaac
attatgacaaatatttgccctacagtaggtagtgataaaaatgagctacaaggtgatggt
ttttgcagaagccaacagtcatcttcaaatgcacactggactaaaggagagactcttgat
gtaagggcaatgatggacacttggacactgcaaaaaggttttcccctggtaactgtcacg
gtgagagggaagaatgtccacctgcagcaggagcgctacatgaagggagtgaattctcct
tcatccacagggtacttgtggcacattccactaacctacattaccagtaaatctgacact
gttcagagatttttgatgacaactaaagcagatgtcattattcttccggaagaggtggag
tgggttaaattcaatgtggatatgaatgggtattacattgtgcactatgaagatgacgga
tgggatcgtctgattaacgttttgaaagagaaccatacgatgattagcagcaatgacaga
gcaagtctcatcaacaacgtattccagcttgtgagcatcaacaaattgtcaatttccaaa
gcttttgatttaactttgtacctgaaacatgaaagacaaatcatgcctgtactccaaggt
atgaatgagctgattcctatatacaggctcatggagaggagggatatggatggtacagca
aaacagttaaaggagtatataatcaatctatttaaagacttgattgacaggcagtcttgg
agtgatgaaggctcagcatctgagagattgcttaggcactcgctcctgctgtttgcgtgt
gtgcacaggtaccagccgtgcgtggacaaagccaaaggatattttacagaatggcaaaaa
tccaatggaaccttgagcttgccagcagatgtgaagacagcagtgtatgctgttggagca
caaacgtccgaaggctgggatttcctcctcagtaaatacagactgcagttgttcaatgta
gagagagagaacattgaattagctctcagcctcagcagaagtaaggacaaacttcagtgg
ttaatggatcaaggtctgcgtggtgacatcgtaagaactcaggatcttccacatattatt
gtatttgttgccaaaaccccatctggctgtcatctagcttggacgtttttaaaagaaaat
tgggagaaagttgtagaaaaatttgaactcggttccaattctgtagcaaccattgtcact
ggagtgacaagtcggtactcaacaaggtcacagcttgcacaggtgaaggaattcttcagt
tctctagaggaaaaaagcgcacggcttcgctgtgtccagcaagctgttgaaaccattgaa
gacaatatacaatggatggatagaaattttgagaaagtcaaaacatggttgcaaaacaac
cagctgtaa

DBGET integrated database retrieval system