KEGG   Pygoscelis adeliae (Adelie penguin): 103919681Help
Entry
103919681         CDS       T06012                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Brite
KEGG Orthology (KO) [BR:padl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:padl04131]
    103919681 (DOCK8)
Membrane trafficking [BR:padl04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103919681 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N GPR15L
Motif
Other DBs
NCBI-GeneID: 103919681
NCBI-ProteinID: XP_009325499
Position
Unknown
AA seq 2036 aa AA seqDB search
MTRLNNLDSELAQELGDFPEDDLDIVFTPKECRTLQPSLPEDGVELDSHVRDCVQTYIRE
WLIVNRKNQGNSDTCSLKNKGSRKDFHKTLQKQTFESETLDSSDANFQAGPRHVYALPEE
ASRTTLASSDFDLRSLQPDPRLENLLRHVSAEEFERQNEEARRTNRHAELLALYPSVDEE
DAVEIRPVPDRPKEHLGNRILVKLQTLKFDIEIEPLFACIALYDIKERKKISENFHCDLN
PDSLRGFLRSHTPSIDLSTQARSAVFSVTYPSSDIYLVIKIEKVLQQGEIGDCAEPYMVL
KESEAGKTKEKIEKLKVQAESFCQRLGKYRMPFAWIPISLTNFFNLSTLEREIPEAEGLN
GRSTSDKRATLLQARRLSERSLSSEDSYPISNFKTISLTLSTFFKQEGDRLSDEDLFKFL
ADFKRSSSLQRRIKTLPGTLKLEISPAPENLGYCLTPELLPVKPFPENRNRPHKEILEFP
IREVYVPHTIYRNLLYVYPQRLNFANRPASARNITIKIQFMCGEDPSCAMPVIFGKSSGP
EFVQEIHTAITYHNKSPDFYEEVKIKLPAKLTEKHHLLFTFYHISCQPKQGASVETLLGY
SWLPILLNDRLQTGHYCLPVALDKLPFHYSIHSPEKVPSQTPPIKWVEGHKGVFNVEVQA
VSSVHTQDNHLEKFFTLCHSLESQVTFPIRLMDQKITEATLEHELKLSIICLNSSRLEPL
VLFLHLVLDKLFQLAVQPMVIAGQTANFSQFAFESVVAIVNSLHNSKDLSKDQHGRNCLL
ASYVYYVFRLPDPQREVVKAGAGSSAVLTESRYYTFGRTSAVSVGSKLLQSRVISCSNPD
ITVTQTATDEEVKNIMSSKPMDHSSSRMSFYVEGTNDMPSVCASPRPSNKKHFHEELALQ
MVVSTGMVRESVFKYAWFFFELLIKSMAQYVHNIEKQDNPRRSRFSDRFKDDITTIVSVV
TSEIAALLVKPQKETEQAEKINISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSNKLNSLS
TLISMRLEFLRILCSHEHYLNLNLFFMTSASAPASPSPSLSSQNSSSCSSFQDQKIAGMF
DLSAEYRQQHFLTGLLFTELAAALDADSEGISKVQRKAVSAILSLLSSHDLDPRCSKKEV
KIKIAALYLPLVGIILDSLPQLHDFTISDARSGKGRTGNPEEEQESAGAINQNVALAIAG
NQFNLRSSGISLVSLPYRQSATLGPDTTRNLLICFLWIMKNADENLIQKWISDLPSMQLN
RILDLLFICVSCFEYKGKQSSDKVSTQALQKSRDVKARLEEALLRGEGARGEMMKRCRIP
AGNDRSAGLNENLRWRKEQTHWRQTNERQDKTKAELDQEALISGNLATEANLIILDMQEN
IIQASFAAECRDNLLGGVLKVLVNSLGCDQSTTYLTHCFATLRALIAKFGDFLFEEEVEQ
CADLCQRVLHHCSSSIDITRTQACATLYLLMRYSFSSTSNFARVKMQVTMSLASLVGKSP
EFNEEFLRRSLRTILAYAEEDVDMQATPFPIQVEELLCNLNSILSDTVKMREFQEDPEML
MDLMYRIAKGYQTSPDLRLTWLQNMAEKHTKRKCYTEAAMCLVHAAALVAEYLSMLEDRN
YLPVGSVSFQNISSNVLEESAVSNDVLSPDEDGVCSGRYFSESGLVGLLEQAAELFSTGG
LYETVNEVYKIVIPILEAHRDFRKLTLTHSKLQKAFDSIINKGQKRMFGTYFRVGFYGSK
FGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGEDAVEVIKDSAPVDKRKLDPNKAYI
QITFVEPYFDEYEMKDRVTYFEKNFNLCRFMYTTPFTMDGRPRGELSEQYKRNTILTTMH
AFPYIKTRINVIQKEEFILTPIEVAIEDMRKKTQELSAATNQEPPDAKMLQMVLQGSVGA
TVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQREYQ
LELRKNYGKLKENLRPMIERKIPELYKPVVKVHSTRESFRNHSFRKYDAQTSSQST
NT seq 6111 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggctgaacaacttggactcagaactagcgcaagaacttggtgactttcctgaa
gatgacttggacattgtctttacacccaaagagtgcaggactttgcaaccctctctgcca
gaagatggggttgaactggactcgcatgtcagagactgtgttcagacgtatatccgggag
tggctgattgtgaatcgaaagaaccaagggaattcagatacttgtagcctgaaaaacaag
ggatcccgaaaagattttcacaagacgcttcaaaaacaaacatttgaatcggaaacattg
gattccagcgatgcaaactttcaggcaggaccccgacatgtctacgcgctccccgaggag
gcctcgaggacgaccctcgcctcctctgacttcgacctgcgcagcctgcagccggacccc
cgcctggaaaacctgctgcggcacgtcagcgctgaggagtttgagaggcagaacgaggag
gcgcggcgcaccaacaggcacgccgagctcctcgccctctacccctccgtcgatgaggaa
gatgcagtggagatacggccggtgccagatcgcccaaaggaacatctgggcaacaggatt
ttggtgaagctgcagactttgaagtttgatatagagatcgaacctttgttcgcatgcata
gctctctatgatataaaagaaagaaaaaaaatctcagaaaattttcattgtgacctcaac
cctgattcattaagaggattcttgcgttctcatacaccctccattgacttgtctactcag
gcaagatcggcagtattttctgtcacttatccctcatcggatatatacttagtaataaag
atagaaaaagtgcttcagcaaggagaaattggagactgtgcagaaccctacatggttctt
aaagaaagtgaggctggcaagacaaaagaaaagattgaaaaactgaaagtccaagctgaa
tccttttgtcagcggttggggaaatacagaatgccattcgcctggattcccataagccta
actaatttcttcaacctttcaacacttgaacgagaaatacctgaggctgaaggtttaaat
ggtagatccactagtgacaagagagcaacactgctacaggcgagaagactttctgagaga
agtctcagctcagaggacagctatccaatatcaaacttcaaaacaatctctctgaccctc
agcaccttctttaaacaggaaggagacaggctcagtgatgaagatctgttcaaattttta
gcggatttcaaaagatcgtcttccttgcagagaagaattaagactttaccaggaacactt
aaactggagatttccccagctccagaaaaccttggttattgtctgacaccagaattacta
ccagtcaagccatttccagaaaaccgtaatcgtcctcacaaagagattttggaattccca
attagagaagtgtatgttccccataccatttatagaaatctcctctatgtttaccctcag
aggctgaattttgctaaccgaccggcttctgcaagaaacattaccatcaagatccagttt
atgtgtggcgaagacccgtcctgtgcaatgccggtaatttttgggaaatcttcaggtcca
gaatttgtgcaagaaatacacacagctatcacatatcataataagtcccctgacttttat
gaagaagtgaaaattaagctgccagcaaaactcacagagaagcaccatctattgttcacg
ttctatcacatcagctgccagccaaagcaaggagcatctgtggaaaccctcctcggctat
tcatggctgccaattctgttaaatgatcgtcttcaaactggacattattgtcttcctgtt
gcattggataagctgcctttccactattcaattcactctcctgagaaagttccatctcag
acaccaccgattaagtgggttgaaggacacaagggtgttttcaatgttgaagtgcaagct
gtttcatctgttcacactcaggataaccacttggagaagttcttcactctgtgccattct
ctggaaagtcaagtgacattccccattcgactgatggaccagaagattacagaggctaca
ctggaacatgaattgaaactcagcattatctgtttgaattcttcacgccttgaacctctt
gtcttgtttttacatttggtactagataaacttttccagctggctgtacagcccatggtc
atagctggccagacagccaacttctcacagtttgcctttgaatctgtggttgcaatagtg
aacagtctccacaacagcaaagacctgagcaaagaccagcatgggaggaactgcctcctg
gcatcttatgtctactatgtatttcgcctgccagaccctcaaagagaagtagtcaaagca
ggtgcaggcagcagtgccgttttgacagagtctcgttattatacatttggacgcacttcc
gcagtgtctgttgggagtaaactcttgcagagccgagtgataagctgcagcaatcctgac
atcactgttacacaaactgctactgatgaggaggtcaaaaacatcatgtcatccaagcct
atggatcacagctccagccggatgtctttctatgttgaaggaacaaatgacatgccaagt
gtttgtgcaagtccaagaccatccaataaaaagcatttccatgaggagctggcactgcag
atggtggtcagcacgggtatggtgagagaatctgtcttcaagtatgcctggttcttcttt
gagctcctgataaagagtatggctcagtatgttcacaacatagagaagcaagacaaccca
cgaagaagccggttctccgatcgcttcaaagatgatattaccactatagttagtgtagtt
acttcagagattgctgcacttttagtcaaaccacaaaaggaaactgagcaagcagaaaaa
attaatatcagcctggcatttttcttgtatgatcttctttctttaatggaccgaggattt
gtgtttaatctcatcaaacattactgtaatcagctctcaaacaagctgaattcactctcc
accctgatttccatgagactggagttcctgagaattctctgcagccatgagcattacctc
aatctgaacctcttcttcatgacctccgcgtctgctccagcatccccctccccctcctta
tcctcccagaactctagctcctgctctagtttccaggaccagaaaattgctggtatgttt
gacctctcagccgaataccgtcagcagcactttctgaccggcctacttttcactgaattg
gcagcagcgctggatgcagacagtgaggggattagcaaggtgcaaagaaaagctgtcagt
gctatccttagcctgctgagttcccatgacctagacccacgttgctccaaaaaagaggtg
aagattaaaattgcagctctctacctccctttggttggtatcattttggattcactgcca
caactccatgattttacaatttcagatgcccgcagcggaaagggacgcacaggaaaccca
gaagaagaacaagagtctgccggtgcaatcaatcaaaacgtggcccttgccattgcaggg
aatcaattcaacctcaggagctccggaatatctctggtgtccctgccctacagacagagt
gccacattaggtcctgatactactcgcaaccttttgatctgtttcctctggatcatgaaa
aacgctgatgagaatctaatacagaaatggatttcagaccttccatccatgcagttgaac
aggattttagacctcctcttcatttgtgtctcatgctttgagtacaagggcaaacaaagc
tcagataaagttagcactcaagcactccagaagtcacgagatgttaaggcccgattagaa
gaggctttactgagaggtgaaggagccagaggagaaatgatgaagcgctgcagaatacca
gctgggaatgacagatcagcggggctaaatgaaaacctgcgctggagaaaggagcagact
cactggcggcagacaaatgagagacaagataagacaaaagctgagctagatcaagaagct
ctgatcagtggaaacctggcaactgaagctaacctgatcattctcgatatgcaagagaac
atcatccaggcaagctttgcggcagagtgcagagacaatctcttgggaggagttttgaag
gtcctggtaaattctcttggctgtgatcagagcaccacttacctgactcattgctttgct
acgctcagagcactcattgctaagtttggagatttcctgtttgaagaggaggtcgaacag
tgtgctgacctgtgtcaaagagttctccatcactgcagcagcagcatagatattacacgg
actcaagcctgtgccactctttatctcctcatgagatacagcttcagctctaccagtaat
tttgcaagagtgaagatgcaggtgaccatgtcactagcctctctggttggcaaatcacct
gagtttaacgaggaattccttcggcgatccttacgaaccatcctagcctatgcagaggaa
gatgtggatatgcaggcaactccatttcctattcaggtagaggagctgctgtgtaatctg
aacagcatcctgtcagatacagtgaaaatgagggaatttcaggaagatccggagatgctc
atggatctcatgtacagaattgccaaaggataccagacatcacctgacttgaggctgact
tggctgcagaacatggcagagaagcacaccaagaggaagtgctacacagaagcagccatg
tgtctggtccatgctgcagcactggtggcagagtacctcagcatgcttgaagatcgcaac
tatctcccagtgggcagtgtcagctttcagaacatttcgtccaatgtgctggaggaatct
gctgtttcgaatgatgttttgtctccagatgaagatggtgtatgttctgggaggtatttc
tcagaaagtggcctggtagggctgctggaacaagcagctgagctcttcagcacgggggga
ttgtatgaaactgtgaatgaggtgtacaaaattgtcatccccatactggaagcacatcga
gacttcaggaagcttaccttgacacacagcaagctacagaaggcctttgacagcattatt
aataagggtcaaaagcgaatgtttggaacttacttccgtgttggtttctatggatccaaa
tttggggacttggatgaacaggaatttgtttataaggaacctgcaattaccaaacttcct
gagatttctcacagattagagggattttatggccagtgttttggggaggatgctgtggaa
gtgattaaggactccgctcctgtagacaaaagaaagctggatcccaataaggcatacata
caaattacttttgtggagccgtattttgatgagtatgagatgaaagacagagtaacctat
tttgagaagaacttcaacctctgtcggttcatgtacactacgcctttcaccatggatggg
cgccccagaggagagcttagcgagcaatacaagaggaacaccatcctaaccacaatgcat
gctttcccctacatcaaaactagaatcaatgtcatccaaaaagaagagtttattttaacc
ccaattgaagttgctattgaagatatgcggaaaaaaacacaggaactaagtgcagccacc
aaccaagaaccaccagatgccaaaatgctccagatggttttgcagggctcagttggagcc
actgtaaatcagggaccactagaggtagcgcaagtgttcctggctgaaattccagcagac
cccaaactttatcgacatcacaacaagctgaggttgtgcttcaaagagtttataatgagg
tgtggtgaagcagtggagaaaaacaagcgccttattactgctgaccagcgggaatatcag
ctagagcttagaaagaactacgggaagctgaaggagaaccttaggcccatgattgagagg
aagatcccagagttgtacaaacctgtagtgaaagtccatagcacaagggaatcttttcgt
aaccacagttttaggaaatacgatgcccagacttcttcacaaagcacctaa

DBGET integrated database retrieval system