KEGG   Pygoscelis adeliae (Adelie penguin): 103919783Help
Entry
103919783         CDS       T06012                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2 isoform X1
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04010  MAPK signaling pathway
padl04218  Cellular senescence
padl04370  VEGF signaling pathway
padl04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103919783 (MAPKAPK2)
   04370 VEGF signaling pathway
    103919783 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103919783 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103919783 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:padl01001]
    103919783 (MAPKAPK2)
Enzymes [BR:padl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103919783 (MAPKAPK2)
Protein kinases [BR:padl01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   103919783 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 103919783
NCBI-ProteinID: XP_009325616
Position
Unknown
AA seq 346 aa AA seqDB search
MQWSRELLGRTRSDSWRIIAGGGGETESVVPEDVCRQGNMLQDCPKARREVELHWRASQC
AHIVRIMDVYENLYQGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAI
QYLHSINIAHRDVKPENLLYTSKRPNAVLKLTDFGFAKETTTHNSLATPCYTPYYVAPEV
LGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKKRIRMGQYEFPNPEWSEV
SEEVKQLIRNLLKTDPTQRMTITEFMNHPWIMQSMQVPQTPLHTSRVLKEEKDLWEDVKE
EMTSALATMRVDYEQIKIKKIEDSSNPLLMKRRKKANPTEPAALPH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggagtagggagctgcttgggcgaacacgcagtgattcatggcgcatcatcgca
ggaggaggcggcgagactgaatcagtggtgcctgaggatgtgtgcaggcaagggaatatg
ctgcaggactgcccgaaagcccgcagggaagtggagctgcactggagggcatcgcagtgc
gcgcacattgtccgcatcatggatgtctatgagaacctctaccaggggaggaagtgtctg
ctcatcgtcatggagtgcttggacggcggggagcttttcagccgaattcaagacagggga
gaccaggccttcacagaacgggaggcttcagagataatgaagagcattggggaagccatt
cagtacctacactcgatcaacatcgcgcaccgggatgtgaagccggaaaacctcttgtac
acctccaaaaggcccaatgctgtgctaaaactcacggactttggctttgctaaagaaacc
accacacacaactccttggccactccgtgctacacgccgtactacgtggccccggaggtg
ctgggcccggagaagtacgacaagtcctgcgacatgtggtccctcggtgtcatcatgtac
attctgctgtgtgggtatccccccttctactccaaccacggcctggccatctcacctggc
atgaagaagcgaatccgaatgggccagtacgagtttcccaaccccgaatggtccgaagtg
tcggaggaagttaagcagctgatccgcaacctcctgaagactgacccgacccagcgcatg
acaataacggagttcatgaaccacccctggatcatgcaatccatgcaagtgccccagacc
ccgctgcacaccagccgcgtgctgaaagaggagaaggatctgtgggaggacgtgaaggag
gagatgacgagcgcgctggccaccatgcgagtggactacgaacaaatcaagatcaagaaa
atcgaagattcctcaaaccctttgctgatgaagaggcggaagaaagcaaaccccaccgag
cccgccgcgctcccccactga

DBGET integrated database retrieval system