KEGG   Pygoscelis adeliae (Adelie penguin): 103921910Help
Entry
103921910         CDS       T06012                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04010  MAPK signaling pathway
padl04260  Cardiac muscle contraction
padl04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103921910 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103921910 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    103921910 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:padl04040]
    103921910 (CACNG3)
Ion channels [BR:padl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103921910 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 103921910
NCBI-ProteinID: XP_009328232
Position
Unknown
AA seq 272 aa AA seqDB search
MARNAVAEAAVLEKHRLSLHLAASYLRGTFRGVCKKIDHFPEDADYEQDTAEYLLRAVRA
SSIFPILSVGLLFFGGLCVAASEFYKSKHNVILSAGIFFVSAGLSNIIGIIVYISANAGD
PGQSDSKKSYSYGWSFYFGALSFIIAEMVGVIAVHMYIEKHRQIRARSHSELLKKSAFTR
LPPYRSRFRRRSSSRSTEPRSRDMSPISKGFSTIPSTDISMFTLSRDPSKVTMGTLLNSE
RDHGFLQVHNSIPKEFKESLHNNPANRRTTPV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtaatgccgtggctgaggcagctgtcctggagaagcaccgtctctccctgcac
cttgccgcgagctaccttcgtggaaccttccgaggagtgtgcaagaaaatcgaccacttc
cccgaggatgcagattatgagcaagacacggctgagtatctcctccgtgcagtgagagca
tccagcatcttccccatcctcagcgtgggtctgctgttctttgggggcctatgcgtggcg
gccagcgagttctacaagagcaaacacaacgtcatcctcagcgccggcatcttcttcgtc
tctgcaggtctcagcaacatcatcgggattatagtctacatctcggccaacgcgggggac
ccagggcagagcgactccaagaagagctactcctacggctggtccttctacttcggagcc
ctgtccttcatcatcgccgagatggtgggggtgattgctgtgcacatgtacatcgagaag
caccgccagatccgcgccaggtcccactcggagctgctgaagaagtcggccttcacccgc
ctcccgccctacaggtcccgcttccgccggcggtccagctcccgctccaccgagccccgg
tcccgggacatgtcgcccatcagcaaggggttcagcaccatcccctccaccgacatctcc
atgttcaccctctccagggatccctccaaggtcaccatggggacgctgctcaactcggag
cgggaccacggttttttacaggtccataactccatccccaaagagttcaaggagtctttg
cacaacaacccggccaacagacgaaccacgccggtctga

DBGET integrated database retrieval system