KEGG   Pygoscelis adeliae (Adelie penguin): 103923871Help
Entry
103923871         CDS       T06012                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl00232  Caffeine metabolism
padl00983  Drug metabolism - other enzymes
padl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:padl00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    103923871
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103923871
Enzymes [BR:padl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     103923871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 103923871
NCBI-ProteinID: XP_009330579
UniProt: A0A093RPZ4
Position
Unknown
AA seq 290 aa AA seqDB search
MNLEEYFARTGYKGSLEKQDLETLTDIFQHHIRAVPFENLSIHCGEKITLELEHVYNKIV
RRKRGGWCMENNQLLGWVLKRLGYDTSFLGAYVFNPHQNAYATIMTHLLVKVVIDGKAYV
VDGGFGVSYQMWQPMELVSGKDQPQAPGIFRFTEKNAIWYLEKMRRKQYIPNQNFSNSDL
LEKKECRKVYMFSLEPRTVEDFHFQCMYLQTSPDSLFTKKSICTLQTTDGFRALIGWTLT
ETTYNYKENMDLVEFVTLEDEEVEKTLKEKFNITLDRKLVPINVKGFYTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttgaagagtattttgcaagaactggctataaaggttcccttgaaaaacaagat
ttggaaaccttaaccgatatattccagcaccacatccgtgctgttcccttcgaaaacctc
agcatccattgcggggagaaaattactttggagttggagcacgtttataacaaaatcgtg
cggaggaagcggggtggctggtgcatggaaaacaaccagctgttgggctgggtcctgaaa
cgcctggggtacgacaccagctttctgggagcgtatgtgttcaatccacatcaaaatgca
tacgccaccatcatgacccatctccttgtaaaggtagttattgatggcaaagcctatgtt
gttgacggaggctttggtgtatcctatcagatgtggcaaccgatggagcttgtgtcaggg
aaagaccagccccaggctcctggcatctttcgcttcacggaaaaaaatgccatctggtac
cttgagaaaatgagacggaaacaatatatccccaatcagaatttctctaattctgatctt
ctggagaaaaaagaatgtcggaaagtttatatgttcagccttgagccacggacagtggaa
gatttccatttccagtgcatgtaccttcagacgtctccagattccctctttacaaagaag
tccatctgcaccctccagaccacggatggctttcgagcgctaattgggtggacactcact
gagaccacatacaactacaaggaaaatatggatctggtggaattcgtaactcttgaagac
gaagaggtggaaaaaacactcaaagagaaattcaacataaccctagatagaaaacttgtc
ccaattaacgtcaaaggattttacacaatctag

DBGET integrated database retrieval system