KEGG   Pygoscelis adeliae (Adelie penguin): 103924254
Entry
103924254         CDS       T06012                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Brite
KEGG Orthology (KO) [BR:padl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:padl01009]
    103924254 (AKAP5)
Protein phosphatases and associated proteins [BR:padl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     103924254 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 103924254
NCBI-ProteinID: XP_009331019
Position
Unknown
AA seq 465 aa
MAKAAKEIQMENPREVETHSTGTMCSPSEEQAEKPSMLCFKKRKKSCKKGLTVKDACEGA
SEEKSQCVSADQGEAKVSNQSRSSKGAWAAIKNLARPRRRQKSSSRKKVPSDSQVQLEMD
AEEGFAQGFPKKRASSGVKMPCVRFSRGKKKPSPSEAVEESEDSVQANEVMGILNKASEE
PEDLAPTDKSESFSPVSAEEDQDTVKEGTDSVGKSEPLTEPTSDAEEHTECTAKSEITGS
ETVNETAQEELQEGSLPQTTVHAEGREVAPEAPVSKDQLDSTPETTELQEIPNICKELPQ
GDESEKSINLPEECKAEEAVMDFSQSAFKDDAASVQGCSSHQVTLEANAGAGVSIVITVT
EAEDADDTDSDQAYEPSPVLHRNKQKGNKKSSGSFDFGKKEGPEASGGPQAEEKGPGDQG
HRTGEQYELLLIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFM
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcgaaggcagctaaggaaattcaaatggagaacccaagagaggtagagactcacagc
acagggacgatgtgctccccgtcggaggaacaggcagaaaaaccctccatgctctgtttt
aagaagcggaagaagtcctgtaagaaggggctgacggtgaaggatgcgtgcgaaggagcc
tcggaggagaaaagccaatgtgtcagcgctgaccaaggggaggcgaaagtttctaatcaa
tcgcgatcctccaaaggagcctgggcagccatcaaaaatctcgcaagacctcggagaagg
caaaaatcctcctcgcggaagaaggtgccctctgattcccaagtgcagctggagatggat
gctgaggagggcttcgcgcaaggcttcccaaagaaacgggcgagctctggggtgaagatg
ccctgcgtacggttctccagaggcaagaaaaaacccagcccctctgaagcagtggaggag
tcggaggacagcgttcaggcaaatgaagtgatgggcattttgaataaagctagtgaagag
ccagaggatttggccccgacagacaagtctgaatccttcagcccagtctctgcggaggag
gaccaggatacggtgaaggaaggcaccgactctgttgggaagagcgagcccttgacagag
cccacatctgatgcagaggaacatacggagtgcaccgctaagtcagagataaccggttca
gagacagttaatgaaacagcccaggaagaactgcaggaggggagcctaccccaaaccacg
gtccacgcagaaggcagggaagttgctcccgaagcgcccgtttccaaggatcaactcgac
agcacccctgaaaccaccgagctgcaggaaatccctaatatctgcaaagagctgcctcaa
ggggatgaatcagaaaagagcataaatcttcctgaggagtgcaaagccgaagaggctgta
atggatttcagtcagtcggcatttaaagatgatgcagcgagcgtgcagggctgctccagc
catcaggtgacattagaagcaaacgcaggtgccggcgtcagcattgtcatcaccgtcacc
gaagccgaggatgctgacgacacagactctgaccaggcctatgaaccgtccccggttttg
caccgaaataagcaaaaagggaataaaaaatcaagcgggagctttgattttggtaaaaaa
gagggccccgaggcgagcggcggtccccaggcggaggagaaaggtccaggcgaccagggg
cacagaactggggagcagtacgaattgctcctcatagaaaccgcgtcttcccttgtgaag
gcggccattcagtcatccatagagcagctggtcaacgaaatggccctggaacagaataaa
cacaacagttttatgtga

DBGET integrated database retrieval system