KEGG   Pygoscelis adeliae (Adelie penguin): 103924625Help
Entry
103924625         CDS       T06012                                 

Gene name
FKBP7
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP7
  KO
K09573  FK506-binding protein 7 [EC:5.2.1.8]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Brite
KEGG Orthology (KO) [BR:padl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:padl03110]
    103924625 (FKBP7)
Enzymes [BR:padl01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103924625 (FKBP7)
Chaperones and folding catalysts [BR:padl03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    103924625 (FKBP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 103924625
NCBI-ProteinID: XP_009331461
Position
Unknown
AA seq 182 aa AA seqDB search
HLPEVCSPRSKKGDLLNAHYDGFLASDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAM
MNMCPGEKRKVIIPPSLAYGQQGYAQGKIPPNATLIFEIELYAVNKGPRSVEAFHQIDKD
SDKKLSELEISQYLKEEFARDGKKRHPSVHDEILADIFKKNDHDGDGFISAKEYNVYQHD
EL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
cacctccccgaggtctgcagcccgaggagcaagaagggggatctgctgaacgcgcactac
gacggtttcctggccagcgacggatccaagttttactgcagtcggacgcaaaatgaaggt
catccaaaatggttcgttctgggtgttggacaagtcataaaagggttagatattgctatg
atgaatatgtgtcctggagaaaaacggaaagtgatcattcctccgtcattagcatatgga
cagcaaggatacgcacagggcaagattccacccaatgcaacgctgatctttgagattgaa
ctttatgcagtaaataagggacctcgcagtgttgaagcatttcatcaaatagacaaggac
agtgacaagaaactctctgaacttgagataagccagtatttgaaagaagaatttgcaaga
gatggcaaaaaacgtcatccctcagtccatgatgaaatcttagctgatatatttaagaag
aatgaccatgatggagatggtttcatatcagcaaaggagtacaatgtctaccagcatgat
gaactctaa

DBGET integrated database retrieval system