KEGG   Pygoscelis adeliae (Adelie penguin): 103924951
Entry
103924951         CDS       T06012                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:padl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103924951 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:padl03000]
    103924951 (MECOM)
Transcription factors [BR:padl03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    103924951 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED Zn-ribbon_8 zf-C2H2_11 zf-met zinc_ribbon_15 PyrI_C
Other DBs
NCBI-GeneID: 103924951
NCBI-ProteinID: XP_009331840
Position
Unknown
AA seq 1045 aa
MKSEGYSHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVEEDFQK
KLENENDLQDVHEIQECKECDQVFPDLQSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLLPTSSPVKGLPSADQTNKSQSPLMTNPQILPATQDILKALNKQ
PSVGENKPVELQPERSSEERPHEKLSDQSESSDLDLDDVSTPSGSDLETTSGSDLESDIE
SEKEKFKENGKMFKDKVSSLQSLASINNKKDHSNHSIFSPSLEEQTAVSGAVNDSIKAIA
SIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKVEPQS
PSEIKKIPKGSSESPFDLTIKRKEEKPLTPITSKPAAPSAASQDQPLDLSMGSRSRASST
KQAEPRKNHVFGEKKGGDLEQRKASESSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEK
YLRPSPGFLFHPQMSAIENMAEKLESFSALKPEANELIQSVPSMFNFRAPPSVLPETLLR
KGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKE
KPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTEI
RNFIGNSNHNNQSPRNSEERMNGSHFKDEKAMVASQNSDLLDDEEAEDEVMMDEEDEESE
IAGKAVKEPVTSDMHERTPEEDYEETSTLDMNCKASPGRYKEEEYKTTGLSALDHIRHFT
DSLKMRKMEENQYSEAELAAFNTSQLPEDLKQPLYRKSKSQAYAMMLSLSDKDSLHSASH
NSPNMWHSMARAAAESSAIQSISHV
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgaagagtgaaggttattcgcatgaaacaatggctccggacattcacgaggagcgccag
tatcgctgcgaggactgtgaccagctctttgagtccaaggctgagcttgtagaccaccag
aagttcccctgcagcacacctcactctgcgttctccatggtggaggaggacttccagaaa
aagcttgagaatgagaatgaccttcaggacgtgcatgaaatccaggagtgtaaagagtgt
gatcaggtcttcccagacttacaaagcctggagaagcacatgctgtcgcacagcgaggag
agggagtacaagtgcgaccagtgccccaaagcttttaactggaagtcaaacttgatacgt
caccaaatgtcgcacgacagcgggaagcactatgagtgtgaaaactgtgccaaggttttc
acggaccccagcaaccttcagaggcatattcgttcccagcatgttggggctcgtgctcac
gcttgtccagagtgtggcaaaacctttgccacttcttcaggcctcaaacagcataaacac
atccacagcagtgtcaaaccttttatatgtgaggtctgccataaatcctatactcagttt
tcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgtgag
ggcaagaaccattttgcagcaggaggattttttggccaaggcatttcacttcctggaacc
ccagctatggataaaacgtccatggttaatatgaatcatgcaaatccgggccttgctgac
tattttggagccaataggcatcctgctggtcttacctttccaacagctcctggattttct
tttagcttccctggtctgtttccttcaggcttgtaccacaggccacctttgctacctact
agttctcctgttaaaggactaccgagcgcagatcagacaaacaaaagtcaaagtcccctc
atgacaaatcctcagatactgccagccacccaggatattttgaaggcactaaataagcaa
ccatcagtaggggagaataagccagtggagcttcaaccagagaggtcctctgaagagagg
ccgcatgagaaactcagtgaccagtcagagagtagtgaccttgaccttgacgatgtcagt
acccccagtggcagtgacctggaaaccacctcgggctctgatctggaaagtgacattgaa
agtgagaaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagctctctg
cagagcctggcttcaataaataataagaaagaccacagcaatcattccattttctcacca
tccttagaggagcagactgcggtgtcaggagcggtgaatgattctataaaggctattgct
tctattgctgaaaagtactttggttcaacaggacttgtggggctgcaagacaaaaaagtt
ggagccttaccttacccttccatgtttcccctcccattttttccagcattctctcaatca
atgtatccatttcctgatagagacttgagaccgttacccttgaaagtggagccccaatca
cccagtgaaataaagaagatcccaaagggaagctctgagtctccctttgacctcaccata
aagcgtaaggaggagaagccacttactcccataacctcaaagccagcagccccctctgcg
gcaagccaggaccagcctctagatctcagcatgggcagcagaagtcgagccagcagcaca
aaacaagctgagcctcggaaaaaccacgtctttggagaaaagaaaggaggtgacctcgag
caaaggaaagcttcggagtcctccttgcagcacgccaggcccaccccgttctttatggat
cccatttacagagtagagaaaagaaagttaactgacccactggaagctttaaaagagaaa
tacttgagaccttccccgggattcttgtttcatccacaaatgtcagctatagaaaacatg
gccgaaaagctggagagctttagcgccctgaaaccggaggccaacgagctgatccagtcg
gtgccatccatgttcaacttccgcgcgccaccgagcgtcctgcccgagaccctgctgcgg
aagggcaaggagcgctacacctgcagatactgtggcaagattttcccgagatctgcaaac
ctaacacgtcacctgaggacgcacactggagaacagccctatagatgcaaatactgtgac
agatccttcagcatatcttctaacctgcagagacatgtccgtaacatccacaataaagag
aagccgttcaagtgtcacttgtgtgacaggtgttttggtcaacaaaccaatcttgacaga
catctaaaaaaacatgagaacgggaacatgtctggtactgcaacatcttcacctcactca
gaactggaaagcacaggggcaatcctagatgacaaggaagactcttacttcacagaaatt
aggaattttattggaaacagcaaccacaacaatcaatcgccccgaaactcagaggagaga
atgaatggcagccactttaaggatgaaaaagccatggtagccagccagaactcagatttg
ctggatgatgaagaggcagaagatgaagtcatgatggatgaagaagacgaagagagtgaa
attgcagggaaagcagtcaaagagcctgttacgagtgacatgcacgagaggactccagag
gaggattacgaggaaacgagtactttggacatgaactgcaaagcttcccctggcaggtat
aaagaggaggagtataagacaactggactttcggctttggaccacataaggcacttcaca
gatagcctcaaaatgaggaaaatggaagaaaatcaatatagtgaagctgaactggcagct
ttcaatacttcccagctgccagaggatctaaaacagccgttgtacaggaaatccaaatcc
caggcgtatgcgatgatgctctctctctctgacaaggactcccttcattctgcatcccac
aattcacccaatatgtggcacagtatggcgagagccgctgcagaatccagcgccattcaa
tccatcagtcacgtatga

DBGET integrated database retrieval system