KEGG   Pygoscelis adeliae (Adelie penguin): 103925468Help
Entry
103925468         CDS       T06012                                 

Gene name
ENOSF1
Definition
(RefSeq) LOW QUALITY PROTEIN: mitochondrial enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl00051  Fructose and mannose metabolism
padl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:padl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103925468 (ENOSF1)
Enzymes [BR:padl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     103925468 (ENOSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C
Motif
Other DBs
NCBI-GeneID: 103925468
NCBI-ProteinID: XP_009332468
Position
Unknown
AA seq 373 aa AA seqDB search
MATQIWVQIICAVTAFFIHVVNRDMGEIVNNFGGFYRELTSDRQLCWIGPEKGAVHLAIA
AILNALWAMREEKLMLMGSQYKNAHCFREIPCSWLPSFAHLDAKQLPFYMDFRYTTDVLT
DEEAYEILQNGLLGKKEREDQMSKHGYLAYTRSCAWLGYSDRILKRLCTXALREGWTTFR
VKVGADLQDNICRCRLIXEMIGLDKIVMLDANQQWEIKKAIEWVTNXAEFKPSWIKGPTF
PDEDMHVQMGHATVPKALAPLGIGVATRKHCHNRVISKQLLQAKALSYLKIDSCRLGSVN
ENFSVLLMAKNSRVRLCKHGLGGLCELVQHLIIFDYIPVSESLESRYSKPGLYSIFRHFT
DASHYGSKLTKSD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggccacccagatctgggtgcaaatcatatgtgctgtcacggctttctttattcacgtg
gtcaatagagacatgggagaaattgtcaacaactttggaggcttctacagagagctcacc
agcgacaggcaactctgctggattggaccagagaagggtgctgtgcacttggccatagct
gccatcctgaatgctctgtgggccatgcgagaggaaaagttaatgctcatgggatctcag
tataagaatgctcattgtttcagagagattccctgctcctggttgccctcatttgcacat
ctggatgccaaacaattgccattctacatggatttcaggtatactactgatgtgctaaca
gatgaagaagcttatgaaatactccaaaatggcctgcttgggaaaaaggaaagggaagac
caaatgtcgaagcatgggtatctggcttatacaagatcctgtgcctggctgggctactca
gacaggatactcaagagattatgcacataggccttgagagaaggctggacaacgttcaga
gtaaaggtgggtgcagatctgcaggataatatttgcagatgcagattgatatgagaaatg
attggcctagacaaaatagtgatgctggacgcaaaccaacaatgggaaataaagaaagca
atagagtgggtcactaacncagctgagtttaaaccctcgtggattaaggggccaactttt
ccagatgaggatatgcatgtccagatgggacatgcaaccgttccaaaggccttagcacca
ctaggaattggtgtggcaaccagaaaacactgccacaacagagtgatatctaaacagctt
ctacaagctaaggccttgagttatctcaaaattgacagctgcaggctgggaagtgtgaat
gaaaacttctctgtgctgctgatggccaaaaattccagagtaaggctctgcaagcatgga
cttgggggtctctgtgaattagttcagcacttgataatatttgattatattccagtatct
gaaagccttgaaagcaggtactcgaaacctgggctgtactccatattcagacacttcaca
gatgccagtcactatggtagcaaactcaccaagtcagactaa

DBGET integrated database retrieval system