KEGG   Pygoscelis adeliae (Adelie penguin): 103926221Help
Entry
103926221         CDS       T06012                                 

Gene name
MRPL53
Definition
(RefSeq) 39S ribosomal protein L53, mitochondrial
  KO
K17434  large subunit ribosomal protein L53
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Brite
KEGG Orthology (KO) [BR:padl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:padl03011]
    103926221 (MRPL53)
Ribosome [BR:padl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    103926221 (MRPL53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 103926221
NCBI-ProteinID: XP_009333337
Position
Unknown
AA seq 92 aa AA seqDB search
MPLSVAEPVGEDLKFLRCINHKKIQATNRNCEVTADVRHDGSEPLVDVMFADGERLIMKG
ANLTTIEMLTALRSRCNAKELQEEQKSKRKSP
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgcccctctcagttgctgagcctgtaggtgaggatctaaaatttcttagatgtataaac
cacaaaaaaatccaggccactaatagaaactgtgaagtgactgctgatgtgcgacacgat
gggtctgaaccacttgtagatgttatgtttgctgatggagagcgattgataatgaaggga
gccaacttgacgacaatagaaatgttaacagcattgcggtccagatgcaatgcaaaagag
cttcaggaagaacagaaaagcaagaggaagagtccctga

DBGET integrated database retrieval system