KEGG   Pseudomonas aeruginosa PAO1: PA0639
Entry
PA0639            CDS       T00035                                 
Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: Prok-JAB NLPC_P60
Other DBs
NCBI-GeneID: 880921
NCBI-ProteinID: NP_249330
UniProt: Q9I5S7
Position
693596..694366
AA seq 256 aa
MELSRSLQRAIAAHAAREHPRECCGLIVRGVRQRRYVACRNAAGSPSEHFVIDHQDWCAA
EDQGEVLAIVHSHPDVPATPSMADRVSCELHGLPWVILSWPEGDVAHLAPEGYRAPLLGR
EFAHGVLDCWSLCRDWYRREAGLELPDYPRRDGWWETGESLYEQHYAAAGFRPVPLAGIR
RGDMLVMQVGRALHPNHAGIYLGNDWRLDSEPVQALGGDGPFLLHHLYGRLSTRDVFGGP
WIERTRLVLRHTRMPQ
NT seq 771 nt   +upstreamnt  +downstreamnt
atggaactgagccgcagcctgcagcgggccatcgccgcacacgccgcccgcgagcatccg
cgcgaatgctgcgggctgatcgttcgcggtgtgcgtcaacgccgctacgtggcctgtcgc
aacgcagccggatcgcccagcgagcacttcgtgatcgatcaccaggactggtgcgctgcc
gaggaccagggcgaggtcctggccatcgtccacagccacccggacgttccggccacgccg
agcatggccgatcgggtcagttgcgaactgcatggtctgccctgggtgatcctgtcctgg
ccggaaggcgatgtcgcgcatctagcgccggagggctatcgggcgccgctgctcggccgc
gagttcgcccacggcgtgctcgactgctggagcctctgtcgcgactggtaccgccgcgag
gcaggtttggagcttccggactatccgcgccgcgacggttggtgggaaaccggcgagagc
ctctacgagcagcactatgcggcggctggattccggccggtgccgctggccggaatccgc
cgcggcgacatgctggtgatgcaggtcgggagggcgctgcacccgaaccacgcgggcatc
tacctgggcaatgactggcgtctggacagcgagccggtccaggcgctcggcggcgacgga
ccgttcctgctgcaccacctgtacggacggctgtcgacccgcgacgtgttcggcggaccc
tggatcgaacgcacgcgcctggtcttgcggcacacgcggatgccgcagtga

DBGET integrated database retrieval system