KEGG   Pseudomonas aeruginosa PAO1: PA0640
Entry
PA0640            CDS       T00035                                 
Name
(RefSeq) bacteriophage protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: Lambda_tail_I Halogen_Hydrol
Other DBs
NCBI-GeneID: 880690
NCBI-ProteinID: NP_249331
UniProt: Q9I5S6
Position
694421..695023
AA seq 200 aa
MSDTLSQGLTTIRLYGVLGKRFGRMHGRLLESGTVREAMSALKHTMEGFETFMREAESKG
LTFAVFRGRTNLSGEQLDMRGREDIRIVPLVIGSKQAGLFQTILGAALIVVGGFTTFFSG
GTSSFLVTAGVSMLAGGVMQMLSPQPKGLKGREAPENAPSYAFGGPVNTIAQGHPVGVLY
GKRRIGGAVISAGIYAEDRL
NT seq 603 nt   +upstreamnt  +downstreamnt
atgagtgacaccctgagtcagggcctcaccaccatccgtctgtacggggttctgggcaag
cgcttcggccgcatgcacggccgattgttggaaagcggcacggtacgcgaggcgatgagt
gccttgaagcacaccatggagggattcgagacgttcatgcgcgaggcggaatcgaaaggg
ctgaccttcgccgtgttccgtgggcgtaccaacctgtccggcgagcaactggacatgcgc
ggacgcgaggatatccgcatcgtgccgttggtgatcgggagcaagcaggcggggcttttc
cagacgattctgggggctgccttgattgtcgtgggtggattcacgacgttcttctccggt
ggaaccagttcgttcctggtaaccgctggagtcagcatgttggcgggcggcgtcatgcag
atgctcagtccccaacccaagggcctgaagggccgcgaggcccccgagaacgcccccagc
tatgccttcggcggcccggtcaacaccatcgcccagggccatccggtcggcgtgctctac
ggcaagcgccgcatcggcggcgcggtgatcagcgccggcatctatgccgaggaccggctg
tag

DBGET integrated database retrieval system