KEGG   Pseudomonas aeruginosa PAO1: PA0036Help
Entry
PA0036            CDS       T00035                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00260  Glycine, serine and threonine metabolism
pae00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01130  Biosynthesis of antibiotics
pae01230  Biosynthesis of amino acids
Module
pae_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PA0036 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PA0036 (trpB)
Enzymes [BR:pae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PA0036 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 879212
NCBI-ProteinID: NP_248726
PathoGenesis: PA0036
UniProt: P07345
Position
complement(37890..39098)
Genome map
AA seq 402 aa AA seqDB search
MTSYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDPAFQEELAYFQRDYVGR
PSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGM
HGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLAEKEGRLPDSLVACIGGG
SNAMGLFHPFLDDAGVQIVGVEAAGHGIDTGKHAASLNGGVPGVLHGNRTFLLQDADGQI
IDAHSISAGLDYPGIGPEHAWLHDTGRVEYTSITDDEALEAFHTCCRLEGIIPALESSHA
LAEVFKRAPSLPKEHIMVVNLSGRGDKDMQTVMHHMQQESKA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctatcgcaacggccccgacgccaagggcctgttcggccgcttcggcggccag
tacgtcgccgagaccctgatgccgctgatcctcgacctcgcccgcgagtacgagaaggcc
aaggacgacccggcgttccaggaggaactggcctacttccagcgcgactacgtcggtcga
ccgagcccgctgtacttcgccgagcgcctgaccgagcactgcggcggggcgaagatctac
ctcaagcgcgaggagctgaaccataccggcgcgcacaagatcaacaactgcatcggccag
atcctcctggcccggcgcatgggcaagaaacgcatcatcgccgagaccggcgccggcatg
cacggcgtggccactgccaccgtcgccgcgcgcttcggcctgcagtgcgtgatctacatg
ggcaccaccgacatcgaccggcagcaggccaacgtcttccgcatgaagctgctgggcgcc
gaggtgatcccggtgaccgccggcaccggtaccctgaaggacgccatgaacgaggcgctg
cgcgactgggtgaccaacgtcgacagcaccttctacctgatcggcacggtcgccggcccg
catccgtacccggcgatggtccgcgacttccaggcggtgatcggcaaggaaacccgcgag
caactggccgagaaggaagggcgcctgcccgattcgctggtcgcctgcatcggcggcggc
tccaacgccatgggcctgttccacccgttcctcgacgacgccggggtgcagatcgtcggc
gtggaagccgccggccacggcatcgacaccggcaagcacgcggccagcctgaacggcggg
gttcccggcgtgctgcacggcaaccgcaccttcctgctgcaggacgcggatggccagatc
atcgacgcacactccatctccgccggcctcgactatcccggcatcggcccggaacacgcc
tggctgcacgacaccggccgcgtcgagtacacctcgatcaccgacgacgaagccctggag
gccttccacacctgctgccgcctcgaaggcatcatcccggcactggaaagctcccatgcc
ctggccgaggtcttcaagcgtgcgcccagcctgcccaaggagcacatcatggtggtgaac
ctgtccggtcgcggcgacaaggacatgcagaccgtcatgcaccacatgcaacaggagtcg
aaagcatga

DBGET integrated database retrieval system