KEGG   Pseudomonas aeruginosa PAO1: PA0041
Entry
PA0041            CDS       T00035                                 

Definition
(RefSeq) hemagglutinin
  KO
K15125  filamentous hemagglutinin
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pae00536]
    PA0041
Glycosaminoglycan binding proteins [BR:pae00536]
 Heparan sulfate / Haparin
  Microbial pathogens
   PA0041
SSDB
Motif
Pfam: Fil_haemagg DUF637 Haemagg_act Fil_haemagg_2 CdiA_C
Other DBs
NCBI-GeneID: 878601
NCBI-ProteinID: NP_248731
UniProt: Q9I791
Position
42914..53521
AA seq 3535 aa
MDIRSPLNQCIALSLAGILFLNPIVAAAAGLALDKAAGGNTGLGQAGNGVPIVNIATPND
AGLSNNHFRDYNVGANGLILNNATGKTQGTQLGGIILGNPNLKGQAAQVILNQVTGGNRS
TLAGYTEVAGQSARVIVANPHGITCQGCGFINTPRATLTTGKPIMDGQRLERFQVDGGDI
VVEGAELNVGNLEQFDLITRSAKLNAKLYAKNLNIVTGRNDVQADSLQATPRAADGSEKP
QLAIDSSALGGMYAGAIRLVGTEQGVGVRLAGDMAASGGDIRIDASGKLSLAQASSQGDL
KIAAQAVELNGKTYAGGSAEIRSAEELVNRQSLAARERIVLEAAHIDNAGVIEAGVEPDE
RRNARGDLELRSGTLRNAGSLVASRALEAKASQALDNQGGSLKGATVRVDAGHLDNRGGK
LLAEGELRVEASSLDNRQDGLLQSRDRAVVKTRGDLDNRGGQVIGLNDLEVGAATLDNGQ
QGLLGSQQSTRVSAQALVNRGDGEVSGKRVEARVGSLDNRGGKLIGDDLLVVASGAIDNR
LGLFSAANRLDLRARSLDNSGKGTLSSRGGLEVSLGGLLDNRDEGNLLSQGAQRVTVGQL
DNRAGGLLSSRSELNVHGASLDNRGGVLVADAGLSATGGAFDNRDGGSASGKAGVRVEVA
SLRNDQGGKLLSDGRLDLAANAVGNAGGRIAAKGDLQATLGSLAQQGGELVSEKTLKVAA
DTLDNSQSGLIAANGGIAIEARQVDNRAGEISSTSKVAVNAREQLDNRGGKVIGDSGLRL
TVQRLLNQAKGVLAGRDGLSLDGGELFNGDGGRLDSQNSLSVSLGGVLDNQGGALVSEGS
LTARAARLDNRGGTFSSAGALALTSQAALDNQGGRLLSDAGVTLQGASLDNSRSGVISAK
GAVDIRTGVLDNSRNGGIGSNAGITLVAARLDNGQQGRVSAKGLLDANLKGLDQRGGGVL
ISETGVTLDLNGGTLVNRDGGLIATPGALLLRQLGAVDNGAGGEISSDRAFTLAAASLDN
RGGRLIGAANLTLRIAQALDNSLAGVISGAAGLDIAAARLDNSAKGTLASRAGIDLRVDG
ALDNHAEGTVSGARLTLASASLDNSGKGLLSGNAGLSVATGALDNAEGGQLISQGVLDVS
SADLDNRGGALSGKQSLRLSAANLDNRGGLLTSDGELELTAGRVDSADGGEISARGDLRL
TVERLVQRQGRLVGERGVSLDLRGGDLDNQGGLISARGPLSIERLSVLDNRQGGEISSQQ
GFELLARRIDNGQQGRIISAGKLRLDADALGNAGAGLLSGWQGLTVTGGSLDNSAGGTLS
SKDGELAISLGGALDNHGQGALVSKGAQRIDAASLDNAQGIVSGESDVTLSIAGKLDNGQ
GGLVSAQRALSFERDDTLLNNAGGRINGGSLLLKGASLDNSDGQLISQGRLDAILGGALV
NTGAARLASGGDLLLRSASVDNRGGKLVSQGLLEISAGSLDNSASGTLASQAGMSLRLGG
GALRNQQDGLIFSQAGALDVQAGSLDNRQGTLQAQGDNRLRIGGALDNQGGRLDSRAGNL
DLQSGSLDNGAGGVLNSAKGWLKLVTGLFDNSAGVTQAQSLEIRAGQGVRNQQGHLSALG
GDNRIVTADFDNQGGGLYASGLLSLDGQRFLNQGAAAGQGGKVGAGRIDFSLAGALANRF
GQLESESELHLRAAAIDNSGGSLRALGRSGSTRLVAGGLNNAYGVLESANQDLDLQLGSL
ANAGGRILHTGNGTFGLDSGQVIRAGGELTTNGLLDIRASEWTNSSVLQAGRLNLDIGTF
RQTAEGKLLAVQSFTGRGGDWSNDGLLASDGSFRLDLSGGYRGNGRATSLGDFALNAASL
DLGNAASLAGGANVTLGAGNLLVNRGRITAAGDLVASAASLNNYGTLGGGGNLRLNAPAL
LNERGLLFSGADMTLRAGDITNLYGDVYSLGRLDIARDDAGNRAASLRNLSGVIESGKDF
SLRASLIENRRAVLESKSGLYTAKMEQTACIEGVNAGDCSGKRNAIWTITQRDKTEVTAS
SAMGQLLAGGDFAIDGGTLNNLSSLIGSGGNLTANLEVLDNQGLETGELETIRVLRTARG
GDIGGIDQKSRNFTNLYWYQSANFDPARAGEIPAALNAILSDWSFEYEFPSKGPTPISSG
DQSYAAVIQAAGDVTVNASTRIDNGVTRPGYTFVGSGRQVGDSAVGGSGVSVVVPLTSQL
PPDLARRQVNPVTLPGFSLPQGDNGLFRLSSRFAEDGNGSAALGAGADRTQGGSGVSVGQ
QGAGNAAGTWQGQGVRVDGLAGAANVQGQGGSTLGGSLPGVARVQGVPGNATPSASHKYL
IETNPALTELKQFLNSDYLLSGLGMNPDDSKKRLGDGLYEQRLIRDAVVARTGQRYIDGL
SSDEALFRYLMDNAIAYKDQLHLQLGVGLSAEQMAALTHDIVWLEEVEVNGEKVLAPVVY
LAQAEGRLAPNGALIQGRDVKLVSGGDLHNVGTLRARNDLSATADNLDNSGLIEAGKRLD
LLAGDSIRNRQGGVIAGRDVSLTALTGDVINERSVTRYDSALDGRTWERSFADSAARVEA
ANSLNVQAGRDIANLGGVLQSRGDLSLDAGRDVTVAAVEDRQGQTRWSTSRLQSVTQLGA
EVSAGRDLNVSAGRDLTAVASTLEARRDIALSAGRDVTLAAAANEEHAYSKTRKVTYQED
KVAQQGTRVDAGGDLAINAGQDLRLIASQASAGDEAYLVAGDKLELLAANDSNYYLYDKK
KKGDFGRKETRRDEVTDVKAVGSQISSGGDLTLLSGGDQTYQGAKLESGNDLAIVSGGAV
TFEAVKDLHQESHEKSKGDLAWNSAKGKGQTDETLRQTQIVAQGNLAIKAVEGLKIDLKH
IDQKTVSQTIDAMVQADPQLAWLKEAEQRGDVDWRMVQEVHDSWKYSNSGMGPATQIAVA
IAAAAIGGMAAAGALSGAGVGASSFAMGAGVGAAGSLSGTAAVSLINNKGDLGKVLKDSF
SSDSLKQIAIASLTGGLTAEYFDGILQTKTDPLTGKVTVDLSSLSGVGRFAANQAMQNAT
STVLSQALGQGGSLNEALKSALYNSFAAAGFNFVGDIGQEYSLKPGDPSMVTMHALMGGL
AAQVSGGDFATGAAAAGANEALVAKLDQAFKSLSPENREAMVTMGSQLVGVLAAAVRDPD
VTGKALESAAWVAKNSTQYNFLNHQDVADLDNALQKCKSQGNCRQVEEEFKARSDENRRR
LNGCVAVGNCAEIRAEIDAGSTALNELVARQETANPGGSDSDIAYGFLMGRNVVDWTTAG
QLHLEQTANLWWNGNPQWQKEVGAYLDQTGFNPFGIGVPAMGGAAGKVTAKALMNALKAG
ELPKGEVAPGKANLPTIGALADAEAGMPYTHPVKLAAKATGTAGKIKIEAGAIPDANEVR
AGQGLSGLGYDVTHQTTASAKGIQGQRTADLHVDGLGSIDVYTPKNLDPTKIVRAIEKKS
NQAGGVLVQADLPSTDMSSIAARMWGKTNAQSIKTIFFQKPDGSLVRFDRPAGGG
NT seq 10608 nt   +upstreamnt  +downstreamnt
atggacatccgcagcccgctgaaccagtgcatcgccctgtccctggccggcatcttgttc
ctcaacccgatcgtcgccgcggcggcggggctggcgctggacaaggccgccggcggcaac
accggcctgggccaggcgggcaacggcgtgcccatcgtcaatatcgccacgcccaacgac
gccgggctgtcgaacaaccatttccgcgactacaacgtcggcgccaacgggctgatcctc
aacaacgctaccggcaagacccagggtacccagctcggcgggatcatcctcggcaacccc
aacctcaagggccaggcggcgcaggtgatcctcaaccaggtcaccggcggcaaccgcagc
accctggccggctacaccgaggtggccgggcagtcggcgcgggtgatcgtcgccaacccg
cacggcatcacctgccagggctgcggcttcatcaacacgccgcgcgcgaccctcaccacc
ggcaagccgatcatggacggccagcgcctggagcgcttccaggtggacggcggcgacatc
gtcgtcgaaggcgccgaactgaacgtcggcaacctcgaacagttcgacctgatcacccgc
agcgccaagctcaacgccaagctctacgcgaagaacctcaacatcgtcaccggccgcaac
gacgtccaggccgacagcctgcaggccacgccgcgcgccgccgatggcagcgagaagccg
cagctggcgatcgacagctcggcgctgggcgggatgtacgccggggcgatccgcctggtc
ggcaccgagcagggcgtgggggtgcggctggccggcgacatggccgccagcggcggcgac
atccgcatcgacgccagcggcaagctgagtctggcccaggcctccagccagggcgacctg
aagatcgcggcccaggccgtggagctgaatggcaagacctacgccggcggcagcgccgag
atccgcagcgcggaggaactggtcaaccggcagagcctggcggcgcgcgaacgcatcgtg
ctggaggcggcgcatatcgacaacgccggggtgatcgaagccggcgtcgagccagacgag
cgacgcaacgcgcgcggcgacctcgagctgcgcagcggcaccctgcgcaacgccggcagc
ctggtggccagccgcgcgctggaagcgaaggcgagccaggcgctggacaaccagggcggc
agcctgaagggggcgaccgtccgggtcgacgccgggcacctggacaaccgtggcggcaag
ctgctcgccgagggcgaactgcgggtcgaggcgagcagcctggacaaccgccaggacggc
ctgttgcagagccgggaccgcgccgtggtcaagacccgtggcgatctcgacaaccgtggc
ggccaggtgatcggcctgaacgatctggaggtcggcgcggcgacgctcgacaacggccag
caaggcctgctcggcagccagcagtccacccgcgtcagcgcccaggcgctggtcaaccgg
ggggacggcgaagtctccggcaagcgcgtcgaggctcgcgtcggtagcctcgacaatcgc
ggcggcaagctgatcggcgacgacctgctggtggtcgccagcggtgccatcgacaaccgc
ctcggcttgttctccgcagccaaccgcctcgacctgcgggcgcgcagcctggacaacagc
ggcaagggcacgctgagcagccggggcggcctggaggtcagcctcggcggcctgctggac
aaccgcgatgaaggcaacctgctcagccagggcgcgcagcgcgtgacggtggggcaactg
gacaaccgcgccggcggcctgctgtcgagccgcagcgagttgaacgtccacggcgccagc
ctggacaaccgtggcggcgtgctggtggccgacgccggcctgagcgccacgggaggcgcc
ttcgacaaccgcgacggcggcagcgccagcggcaaggctggcgtgcgcgtggaggtcgcc
agcctgcgcaacgaccagggtggcaagctgctcagcgatggccgcctggacctcgcagcg
aacgccgtcggcaacgccggagggcgtatcgccgccaagggcgacctgcaggcgacgctt
ggcagcctggcccagcaaggtggcgaactggtcagcgaaaagaccctgaaggtcgcggcc
gacacgctcgacaacagccagtccgggctgatcgccgcgaatggcggcatcgctatcgag
gcgcggcaggtcgacaaccgcgccggcgagatttccagcacctcgaaggtcgccgtgaac
gcccgcgagcaactggacaaccgcggcggcaaggtcatcggcgacagcggcctgcgcctc
accgtgcagcgcctgctgaaccaggccaagggggtgctggccgggcgcgacggcctgagc
ctggacggcggcgaactgttcaacggcgacggcggtcggctcgacagccagaacagcctg
agcgtgagcctcggcggcgtgctggacaaccagggcggcgcgctggtcagcgaaggcagc
ctgacggcgcgcgccgcgcgcctggacaaccgtggcgggaccttctccagcgccggtgcg
ctggcgctgaccagccaggccgcgctggacaaccagggcggcaggctgctcagcgatgcc
ggcgtgacgctgcagggcgccagcctcgacaacagccgttccggcgtgatcagcgccaag
ggcgcggtggatatccgcaccggcgtactggacaacagccgcaacggcggcatcggcagc
aacgccggcatcaccctggtggccgcccggctggacaacggccagcagggccgggtcagc
gccaagggcctgctcgacgccaacctgaaaggcctcgaccagcgcggaggcggcgtcctg
atcagcgaaaccggcgtcaccctcgacctcaatggcggcacgctggtcaaccgcgacggc
ggcctgatcgccacgcccggcgcgctgctgctgcgccagctcggcgcggtggacaacggc
gccggcggggaaatctccagcgaccgcgccttcaccctcgccgccgccagcctggacaac
cgcggcgggcgcctgatcggcgccgccaacctgaccctgcgcatcgcccaggccctggac
aacagcctggccggggtgatctccggcgccgccggcctggacatcgcggccgctcgcctg
gacaacagcgccaagggcaccctggccagccgcgccggcatcgacctgcgcgtcgatggc
gcgctggacaaccacgccgaaggcaccgtctccggcgcccgcctgacgctcgccagcgcc
tcgctggacaacagcggcaagggcctgctctccggcaacgccggcctgagcgtcgccact
ggcgcgctggacaacgccgagggtggccagttgatcagccagggcgtcctggacgtcagc
agcgccgacctcgacaaccgtggcggcgccctcagtggcaagcagtcgctgcgcctgagc
gccgccaacctggacaaccgtggcggcctgctcaccagcgacggcgaactggaactgacg
gcagggcgcgtcgattccgccgacggcggcgaaatctccgcccggggcgacctgcgcctg
acggtcgagcgcctggtgcaacgccagggccggctggtcggcgagcgcggcgtcagtctc
gacctgcggggcggcgacctggacaaccagggcggcctgatcagtgcccgcggcccgctg
agcatcgagcggctgagcgtcctcgacaaccgccagggcggcgagatttccagccagcag
ggcttcgagctgctggccaggcgcatcgacaacggccagcaggggcgcatcatcagcgcc
gggaaactgcgcctagacgccgacgcgctgggcaacgccggcgccggcctgctctccgga
tggcagggcctgacggtgacaggcgggagcctggacaacagcgccggcggcaccctttcg
agcaaggacggcgagctggccatcagcctcggcggcgcgctggacaaccacggccagggc
gcgctggtcagcaagggcgcgcaacggatcgacgccgccagcctggataacgcccagggc
attgtctccggcgaaagcgacgtgaccctgagcatcgccgggaagctggacaacggccag
ggcggcctggtctcggcgcagcgcgcgctgagcttcgagcgcgacgatacgctgctgaac
aacgccggcggccggatcaacggcggcagcctgctgctcaagggcgccagcctggataac
agcgacggccagttgatcagccagggccggctcgacgccatcctcggcggcgccctggtc
aacaccggcgcggcgcgcctggccagcggcggcgacctgctgctgcgcagcgccagcgtc
gacaaccgcggcggcaagctggtcagccaggggctgctggagatcagcgccggcagcctc
gacaacagcgcctccggcaccctcgccagccaggccggcatgagcctgcgcctgggcggc
ggcgccctgcgcaaccagcaggacggcctgatcttcagccaggccggcgccctcgatgtg
caggccggcagcctggacaaccgccagggcacgctccaggcccagggcgacaaccggctg
cgtatcggcggcgcgctggacaaccagggcggccgcctggacagccgggccggcaacctc
gacctgcagagcggcagcctcgacaacggcgccggcggcgtgctcaacagcgccaagggt
tggctgaagctggtcaccgggctgttcgacaacagcgccggcgtcacccaggcgcagtcg
ctggagattcgcgccgggcaaggcgtgcgcaaccagcagggccacctctcggcgctgggc
ggcgacaaccgcatcgtcaccgccgacttcgacaaccagggcggcggcctctacgccagc
ggcctgctcagcctcgacggccagcgcttcctcaaccagggcgcggcggcgggccagggc
ggcaaggtcggcgccgggcgcatcgacttcagcctggccggcgcgctggccaaccgcttc
ggccagttggaaagcgaaagcgagctgcacctgcgcgccgccgcgatcgacaacagcggc
ggcagcctgcgcgccctcggccgcagcggcagcacgcggttggtcgctggcggcctgaac
aacgcctacggcgtgctggaaagcgccaaccaggacctcgacctgcaactgggcagcctg
gccaacgccggtgggcgcatcctccacaccggcaatggcaccttcggcctggattccggg
caggtgatccgcgccggcggcgaactgaccaccaatggcctgctggacatccgcgccagc
gaatggaccaacagcagcgtgctgcaagccggacgcctgaacctggacatcggcaccttc
cgccagacggccgagggcaagctgttggcggtgcagtccttcactggccgcggcggcgac
tggagcaacgacggcctgctggccagcgacggcagcttccgcctcgacctgagcggcggc
taccgtggcaacggccgcgccaccagcctcggcgacttcgccctgaacgccgccagcctc
gacctcggcaacgccgccagcctcgccggcggtgccaatgtcacgctcggcgccggcaac
ctgctggtcaaccgtgggcggatcaccgccgccggcgacctcgtggccagcgccgcgagc
ctgaacaactacggcaccctgggcggcggcggcaacctgcgattgaacgcgcccgccctg
ctcaacgagcgcgggttgctgttcagtggcgccgacatgaccctgcgcgccggcgacatc
accaacctctacggggatgtgtacagcctcggcaggctggatatcgcccgcgacgatgcg
ggcaaccgtgccgccagcctgcgcaacctttccggggtgatcgagagcggcaaggacttc
agcctgcgtgccagcctgatcgagaaccgtcgcgccgtgctggaaagcaagtcgggcctg
tacaccgcgaagatggagcagaccgcctgcatcgaaggcgtcaacgcgggcgactgcagc
ggcaagcgcaacgccatctggaccatcacccagcgcgacaagaccgaggtcaccgccagc
agcgccatggggcaactgctggccggaggcgacttcgccatcgacggcggcaccctgaac
aacctttccagtctgatcggcagcggcggcaacctcaccgccaacctcgaagtcctcgac
aaccagggcctggaaaccggcgagctggaaaccatccgcgtgctgcgtaccgctcgcggc
ggcgatatcggcggcatcgaccagaagtcgcgcaacttcaccaacctctactggtaccag
agcgccaatttcgacccggcgcgcgcgggcgagatccccgccgcgctcaacgcgatcctc
agcgactggtccttcgagtacgaattcccgagcaaggggccgaccccgatcagcagtggc
gaccagtcctacgcagcggtgatccaggccgccggcgacgtcacggtcaatgccagcacg
cgcatcgacaacggcgtcacccgccccggctacaccttcgtcggcagcggccgccaggtg
ggcgacagcgcggtgggcggcagcggggtttcggtggtcgtgccgctgacctcgcaactg
ccgcccgacctggcgcggcgccaggtcaacccggttaccctgcccggcttcagcctgccc
cagggtgacaacggcctgttccgtctcagctcgcgctttgccgaggacggcaatggcagc
gccgcgctcggtgccggcgccgaccgcacccagggcggtagcggcgtctcggtcggccag
caaggcgccggcaacgccgccggtacctggcagggccagggcgtgcgagtcgacggcctg
gctggcgcggccaacgtccagggtcagggcggcagcacgctcggcggtagcctgccgggc
gtcgcccgggtccagggcgtgcccggcaacgccacgccgagcgccagccacaagtacctg
atcgagaccaacccggcgctcaccgaactgaagcagttcctcaactcggactacctgctc
agcggcctgggcatgaacccggacgatagcaagaagcgtctcggcgacggtctctacgag
cagcggctgatccgcgacgcggtggtggcgcgcaccggccagcgctacatcgacgggctg
agcagcgacgaggcgctgttccgctacctgatggacaacgccatcgcttacaaggaccaa
ctgcacctgcaactgggtgtgggcctgagcgcggagcagatggcggcgctgacccacgac
atcgtctggctggaagaggtcgaggtgaacggcgagaaggtcctcgcgccggtggtctac
ctggcccaggcggagggtcggctggcacccaacggtgcgctgatccagggccgcgacgtg
aagctggtgagcggcggcgacctgcataacgtcggcaccctgcgcgcgcggaacgacctc
tcggcgacggccgacaacctcgacaacagcggcctgatcgaggccggcaagcgcctcgac
ctgctcgccggcgactcgatccgcaaccgccagggcggggtcatcgccgggcgtgacgtg
agcctcaccgcgctgaccggcgacgtaatcaacgaacgcagcgtgacccgctacgacagc
gcgctcgacggccgcacctgggaacgcagcttcgccgacagcgccgcgcgggtggaggcg
gcgaacagcctgaacgtccaggccggacgcgacatcgccaacctcggcggggtgctgcag
agccgcggcgacctcagcctcgacgccggacgcgacgtcaccgtcgccgccgtcgaggac
cgccagggccagacccgctggagcacgtcgcggctccagagcgtgacccagctcggcgcc
gaagtcagcgccgggcgggacctgaacgtcagcgccggccgcgacttgacggcggtggcc
agcaccctcgaagcgcgccgcgacatcgccctctccgccgggcgcgacgtgaccctggcg
gcggcggcgaacgaggagcatgcctacagcaagaccaggaaggtcacctaccaggaagac
aaggtcgcccagcaaggcacccgcgtggacgccggcggcgacctggcgatcaatgccgga
caggacctgcgcctgatcgcgagccaggccagcgccggcgacgaggcctacctggtggcc
ggcgacaagctggaactgctggccgccaacgacagcaactactacctgtacgacaagaag
aagaaaggcgacttcggccgcaaggaaacccggcgcgacgaagtcaccgacgtcaaggcg
gtgggcagccagatcagcagcggcggcgacctcaccctgctcagcggcggcgaccagacc
taccagggcgcgaagctggaatcgggcaacgacctggccatcgtcagcggcggcgcggtg
accttcgaggcggtgaaggacctgcaccaggaaagccacgagaagagcaagggcgacctg
gcgtggaacagcgccaaggggaaagggcagaccgatgaaacgcttcggcagacccagatc
gtggcccaggggaatctggcgatcaaggccgtggaagggctgaagatcgacctcaagcat
atcgaccagaagaccgtaagccagaccatcgacgcgatggtgcaggcggatccgcaactg
gcgtggctgaaggaggccgagcagcgcggggatgtggactggcgcatggtgcaggaggtg
cacgatagctggaagtacagcaactcgggcatggggccggcgacgcagatcgctgtcgcc
atcgcggcggcagccatcggtggcatggcggcagcgggagcgctcagtggtgcaggagtg
ggtgccagtagcttcgccatgggcgcaggagttggtgcggcaggaagcctgtcgggcacg
gcagcggtcagcctgatcaacaacaagggcgatctcgggaaggtgctgaaagacagcttc
agtagtgacagtctgaagcagattgctattgcgagcctgaccggggggctgacggctgag
tacttcgacgggattcttcagaccaagactgatccgcttactggaaaggtcacggtagac
ctcagcagcctatctggtgttggtcgcttcgctgccaatcaggcgatgcagaacgctaca
tccactgtactgagccaggccttgggccagggcgggagcctgaacgaggcgctgaagagc
gcgctctacaacagtttcgcggcggcaggtttcaacttcgtcggcgatatcggccaggaa
tacagcctgaagccaggcgatccttcgatggtgaccatgcacgccctgatgggtggcctg
gcggcgcaggtcagcggtggcgatttcgccacgggcgccgcggcggctggcgccaatgaa
gcgctggtggccaagctagaccaggccttcaagagcttgagccctgagaaccgtgaagcc
atggtcactatggggtcgcaattggttggtgttctggctgcggcggtacgcgatcctgat
gtgacaggcaaagctctggaaagcgctgcttgggtagcgaagaactcgacgcaatacaac
ttcctcaaccatcaggatgtggccgatctggataatgccttgcagaaatgcaagtcccag
ggaaattgccgtcaggtagaggaagagttcaaggcgcgtagcgacgagaaccggcggagg
ttgaatggctgcgtggctgtgggtaattgcgcggagattcgtgcggagatcgatgcgggg
tctacggctctcaacgagctggtggcccggcaggaaacagctaatccgggaggaagtgac
agcgatatagcctacggtttcctgatgggccgaaatgttgtcgactggacgacggctggt
cagttgcacctggagcagaccgccaacctctggtggaacggtaatccacagtggcagaag
gaagtcggtgcatacctagaccagacggggttcaatccgttcggaatcggcgttccggca
atgggcggtgccgctggcaaggtaacggccaaggcgctcatgaatgcgctgaaggcggga
gagttgcccaaaggagaggtggccccaggaaaggctaatctgcctaccattggggcgttg
gcggatgctgaggcgggaatgccttatacccatccagttaagctcgccgcaaaagcgact
gggacagcagggaagattaagattgaagccggcgcaatacctgacgcaaatgaagtacgt
gcaggacaagggttatctggtcttgggtacgatgttacgcaccaaaccactgcgtcagct
aaaggtattcaagggcagcgaactgcggacttgcatgttgatggactcggttccattgat
gtgtatacgccgaagaatcttgatccgacaaagatagttcgagcgatagagaagaagtcg
aatcaagccggcggagtcttggtgcaggcggacttgccaagcactgacatgtcgtccatt
gctgctcgtatgtgggggaagactaacgcgcagagtataaaaactatatttttccagaaa
ccagacggatcattggtccgatttgatcgacctgctggaggaggctga

DBGET integrated database retrieval system