KEGG   Pseudomonas aeruginosa PAO1: PA0070
Entry
PA0070            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: Gly-zipper_Omp Gly-zipper_YMGG Rick_17kDa_Anti DUF745
Other DBs
NCBI-GeneID: 879190
NCBI-ProteinID: NP_248760
UniProt: Q9I762
Position
complement(82404..83318)
AA seq 304 aa
MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRAEYYPSCYEPVSHLRST
DNAVRNSAITGAITGGLLGGLAGGLASDENRGRNAALAAAGGALAGGAAGYYMEKQKQIS
DDRARIGSYGTDVDRSTVEINRSVAYAKSAQSCYQSQFKALLDGRKNKSINEAEGRKRLA
EIVSGLQETNALLVAANGRAGENISNYTQAYEKDLQQVGVPRAEVTKVAEAENRASTTKG
GSKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKVASQGQGMIREVCNSPDMGDWAPPS
CAKA
NT seq 915 nt   +upstreamnt  +downstreamnt
atgagccaacccagcgaaaaccgtttgatcacctcggcgcgctacgcgctctgcctgttg
accgccagcggcgtgctgctcagcggctgcgccagcagcggcgtcggctcggtcgcccag
accacccgcgcggaatactacccgtcctgctacgagccggtgtcgcacctgcgcagcacc
gataacgcagtgcgcaattcggccatcaccggcgccattaccggcggcctcctgggcggc
ctggccggcggcctggccagcgacgagaaccgcggccgcaatgccgccctcgctgccgca
ggcggcgccctggccggcggcgcggcgggctactacatggagaagcagaagcagatcagc
gatgaccgcgcgcgcatcggctcctacggtaccgacgtcgaccgcagcaccgtcgagatc
aaccgtagcgtggcctacgccaagtcggcgcaaagctgctaccagagccagttcaaggct
ctgctcgacggtcgcaagaacaagtcgatcaacgaagccgaagggcgcaagcgcctggcc
gagatcgtcagcggcctgcaggagaccaacgccttgctggtcgccgccaacggccgtgcc
ggcgagaacatcagcaactacacccaggcctacgagaaagacctgcagcaggtcggcgta
ccgcgcgccgaggtgaccaaggtcgccgaggccgagaaccgcgccagcactacgaaaggc
ggcagcaagcccaagaccggcagcaatcccaaggtgccgaaggaagcggtcgccaccgag
cagaccatccgcaaggcccaggacgcgcaaagcgaaggcaacaaggtggcctcccagggc
cagggcatgatccgggaagtctgcaacagcccggacatgggcgactgggcgccgccgagc
tgcgccaaggcctga

DBGET integrated database retrieval system