KEGG   Pseudomonas aeruginosa PAO1: PA0077Help
Entry
PA0077            CDS       T00035                                 

Gene name
icmF1
Definition
(RefSeq) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02025  Biofilm formation - Pseudomonas aeruginosa
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA0077 (icmF1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA0077 (icmF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0077 (icmF1)
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA0077 (icmF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C RHH_1
Motif
Other DBs
NCBI-GeneID: 879396
NCBI-ProteinID: NP_248767
UniProt: Q9I755
Position
complement(91521..94826)
Genome map
AA seq 1101 aa AA seqDB search
MQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSERRNLYELPWYVIIGPP
GSGKTTALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQ
VDKAAWLGFLDLLKTQRKRRPIDGAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQL
GVRFPIYVMLTKFDLVPGFMEFFDSLNREERAQVWGMTFALDDGKSAEGPLAVFDSEFAL
LEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLGEFLNGVFKPNPYEERPLLRG
LYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIERLFREVAFGERGLVGT
NPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGIESLSP
AQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTR
IEEQLRSGGSSDFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALH
AHLDALLERRPPSARLDQDLVEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAG
RDAPLVFARKSGKPLTDPLSGFFTYRGYREVFLTASLSQAGTIAEEQWVLGRDLNDAGDA
ANLALDVRRLYFQDYLRQWDDLLADLTVVPITNVTQAADVLRILSGPTSPFRKLLEAVAR
ETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEGAREQPRQVDSDPISAHFAEL
NSLVSKGEGGNEPAPIDSLLEDMNALYVQVSAMAGASGDSLLGDAKNQVAAAASRVALSA
ERQPPVVQGLVKNVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSSRDA
TLEDFGHFFGAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAAI
RDAFFRSGGMQPTVRFELKPVTMDAAISQFILDLDGQQLTYDHGPSRPVAMQWPSANGLG
VVRLTVTPPPSSGRSGLTLEGPWAWFRLLDQSDLERGNSPDRFTLRLRIDGSSIACELRA
SSAFNPFKSRVVSGFSLPERL
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtctcgccgaggtcagcgcgccggacgccgccagcgtcgccaccgccgaagag
ctggcgaccctcaagcaacgcatggacgaggccctggccctgctcaagcgggccaagttg
ggcggcagcgagcggcgcaacctgtacgagttgccctggtacgtgatcatcggcccgccc
ggttcgggcaagaccaccgcgctgatgaattccggcctcgacttcccgctcgccgcgcag
atgggcgccggggcgatccgcggggtcggcggcacgcgcaactgcgactggtggttcacc
gacgaagcggtgctgctggacaccgccggccgctataccacccaggacagccacgcccag
gtggacaaggccgcctggctgggcttcctcgacctgctcaagacccagcgcaagcgccgc
cccatcgatggcgcgttcatcgccatcagcctttccgacctgctgctgggcagcgacgcc
gagcgcgccgcccatgcccaggcgatccgcgcacgcatccaggagctgtaccagcagctc
ggggtgcgcttcccgatctacgtgatgctgaccaagttcgacctggtgccgggcttcatg
gagttcttcgacagcctgaaccgcgaggaacgcgcgcaggtctgggggatgaccttcgcc
ctcgacgacggcaagagcgcggaaggcccgctggcggtgttcgacagcgaattcgccctg
ctcgaacagcgtctcaccgcgcgcctggtggaacgcctgcagcaggagcgcgacccggcg
cggcgcgacctggtctacggcttcccgcagcaattcgccgccctgcgcgaatgcctcggc
gagttcctcaacggcgtgttcaagcccaacccctacgaggaacgcccgctgttgcgcggc
ctgtacttcaccagcggaacccaggaaggcagtccgatcgaccgcctgatcggcagcatg
gcgcagtcgatgaacctcgaccgccagcacctggcgcggcagaccggaaccgggcgcagc
tacttcatcgagcggctgttccgcgaagtggcgttcggcgaacgcggcctggtcggcacc
aacccgaaggtcgagcgccgccgcaagtggctgaccatcggcgcgctgagcgccaccgcg
ctggtggtgctggcggtgacggcggtatggatcgccagctaccgcgccaaccagagctac
atcgccgcggtcgaccagcgcgtcgacccgctggcgcgcggcatcgagtcgctgagcccg
gcccagcgcgacgtcctggccgtactgccacagctcaacgcggtgcagaatctcgccggc
gacgcgccgagctgggccgaaggctacgggctgtaccagggcgacatgctcggcgaggag
tccgccagcgtctaccgcaagctgctgatcgcggtgttcgccccgcgcctggtgacccgc
atcgaggaacagttgcgctccggcggcagcagcgatttcctctacgagggcctgaaggcc
tacctgatgctcggcagcccggaccattacgacgccgacttcatcaaggcctggatcagc
ctcgactgggaacgcaacctgccgcgcgacctctcgccggaacagcgccaggcgctgcac
gcgcacctcgacgcgttgctcgaacgacggccgccgtcggcgcgcctggaccaggacctg
gtcgaggacctgcgccgccagttgcagcaactgccggtggcgcagcgggtctacgaccgg
gtcaagcggcagaggctgcccaaggacgtgcccgacttccgcatcagcgacgccgccggc
cgcgacgcgccgctggtgttcgcgcgcaagagcggcaagccgctcaccgacccgctcagc
ggcttcttcacctaccgcggctatcgcgaggtgttcctcaccgccagcctcagccaggcc
ggcaccatcgccgaggaacagtgggtgctcgggcgcgacctgaacgatgccggcgacgcc
gccaacctggccctcgacgtgcgtcgcctgtatttccaggactacctgcggcagtgggac
gacctgctcgccgacctcaccgtggtgccgatcaccaatgtcacccaggccgccgacgtg
ctgcgcattctctccgggccgacctcgccgttccgcaagctgctcgaggcagtggcccgc
gagaccgacctgcagaagggcgaccggctggtcgccgcgcaagtgaagaaggccgccgac
ggcaccgtggacaagctcaagcagcgcctcggctcgctggtcggccaggaggaagagggc
gcccgcgaacagccgcggcaggtcgacagcgacccgatcagcgcccacttcgccgaactc
aacagcctggtcagcaagggcgagggcggcaacgagccggcgccgatcgacagcctgctg
gaagacatgaacgcgctctacgtgcaggtcagcgccatggccggagccagcggcgactcg
ctgctcggcgacgccaagaaccaggtggccgccgccgcctcgcgcgtggccctcagcgcc
gagcgccagccgccggtggtccagggcctggtgaagaacgtggtcaactccaccaccagc
agcatgatgggcagcgtgcgcaaccagctcaacgcggcctggatcagcgacgtggtcagc
gtctaccggcaatccctggccgggcgctacccgatcgccgccggcagttcgcgcgacgcc
accctggaagacttcggccacttcttcggtgccggcggggtgatggacagctacttccgc
cagtacctgcaaccctacgtcgacacctccgccagcacctggcgctggcagcccggcgcg
gcgcagaagctcggcatcaaccccggcgtgctgcacactttccagcgcgcggcggcgatc
cgcgacgccttcttccgctccggcggcatgcaaccgacggtgcgcttcgagctcaagccg
gtgaccatggacgcggcgatcagccagttcatcctcgacctcgacggccagcagctgacc
tacgaccacggccccagccgcccggtggcgatgcagtggccgagcgccaacggcctcggc
gtggtccgcctgacggtgacgccgccgcccagcagcggccgttccggcctgaccctggaa
ggcccctgggcctggttccgcctgctcgaccagtcggacctggaacgcggcaactcgccg
gaccgcttcaccctgcggctgcgcatcgacggctccagcatcgcctgcgagctgcgcgcc
agcagcgccttcaaccccttcaagagccgggtcgtgtccggcttcagcctcccggagcgc
ctttga

DBGET integrated database retrieval system