KEGG   Pseudomonas aeruginosa PAO1: PA0078
Entry
PA0078            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA0078
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0078
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA0078
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-GeneID: 879392
NCBI-ProteinID: NP_248768
UniProt: Q9I754
Structure
PDB: 
4B62

Position
complement(95048..96397)
AA seq 449 aa
MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGDPYTPPPMASLAPLSG
RGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQFEEKARQAGVAPDEVM
LARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLH
LLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTRGEYEHELSPHWRGLSVMR
DRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKRIHAIGEIPVQAIDRPAVQP
RVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDEFQPLLLRIAD
ALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSD
TEPVATNASAEGRARNRRVEITVFAEGAQ
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgcctcccatcgacgatcccttcggcaccccggccggcggcggcaacggaagcccgccc
gacgaccgcaccatgatcatgccgcgtcccggcggccgcgccccggaaccggccggcggc
ccccgcggcggcgatccctacacgccgccgccgatggccagcctggcgccgctgagcggc
cgcggcgacggcctcaacccgctggagcaggccgccggcccactgctggcgatgctcacc
cgcctgcgcaacaccatcgcccatccggcgccggccagcctgcgcgcgcaactgctcggc
tacctgcgccagttcgaggagaaggcacgccaggccggcgtggcgccggacgaagtgatg
ctggcgcgctacgtgctctgcaccgccctcgacgaagcggtgctcagcacgccgtggggc
agcaccagcgactggggcaagcagagcctgctgatcaccctgcacaacgaggcctggggc
ggcgagaaggtcttccagttgctcgaacactgcctgcagaacccgcaccagcgcctgcac
ctgctggagctgctgtacctgtgcaccagcctcggcttcgaaggccgctaccgggtcatg
cacgacggccgcagccaactggaggcgctgcgcgagcgcaccgcggcggtgatccgcagc
acccgcggcgagtacgagcacgaactgtcgccgcactggcgcggcctcagcgtgatgcgc
gaccgcctttcgcaatacctgccgccgtgggtcggtatcgccatcggcctggccttgctg
ctggccttgctgttcggcctgcggatgaagctggccgccgacgccgagccggtgttcaag
cgcatccacgccatcggcgagatcccggtgcaggccatcgaccgcccggcggtgcagccg
cgggtgatcgagcggccacgcctggcgcgcttcctcgccgacgacatcaaggcccagcga
gtggcggtggaggacgccgtcgaccgctcggtggtgaccatccgcggcgacgagctgttc
gccagcgccagcgccagcgtgcgcgacgagttccagccgctgctgctgcgcatcgccgac
gccctgcgcaaggtcaagggccaggtgctggtcaccggccatagcgacaaccggccgatc
gccacgctgcgctacccgtccaactggaaactgtcccaggcccgcgcccaggaggtcgcc
gacctgctcggcgcgaccaccggcgacgccggccgcttcaccgccgaagggcgcagcgac
accgagccggtggcgaccaatgccagcgccgaaggccgcgcacgcaaccgccgggtggaa
atcaccgtattcgcggagggcgcgcaatga

DBGET integrated database retrieval system