KEGG   Pseudomonas aeruginosa PAO1: PA0078Help
Entry
PA0078            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA0078
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0078
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA DUF883
Motif
Other DBs
NCBI-GeneID: 879392
NCBI-ProteinID: NP_248768
UniProt: Q9I754
Structure
PDB: 

Position
complement(95048..96397)
Genome map
AA seq 449 aa AA seqDB search
MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGDPYTPPPMASLAPLSG
RGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQFEEKARQAGVAPDEVM
LARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLH
LLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTRGEYEHELSPHWRGLSVMR
DRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKRIHAIGEIPVQAIDRPAVQP
RVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDEFQPLLLRIAD
ALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSD
TEPVATNASAEGRARNRRVEITVFAEGAQ
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccatcgacgatcccttcggcaccccggccggcggcggcaacggaagcccgccc
gacgaccgcaccatgatcatgccgcgtcccggcggccgcgccccggaaccggccggcggc
ccccgcggcggcgatccctacacgccgccgccgatggccagcctggcgccgctgagcggc
cgcggcgacggcctcaacccgctggagcaggccgccggcccactgctggcgatgctcacc
cgcctgcgcaacaccatcgcccatccggcgccggccagcctgcgcgcgcaactgctcggc
tacctgcgccagttcgaggagaaggcacgccaggccggcgtggcgccggacgaagtgatg
ctggcgcgctacgtgctctgcaccgccctcgacgaagcggtgctcagcacgccgtggggc
agcaccagcgactggggcaagcagagcctgctgatcaccctgcacaacgaggcctggggc
ggcgagaaggtcttccagttgctcgaacactgcctgcagaacccgcaccagcgcctgcac
ctgctggagctgctgtacctgtgcaccagcctcggcttcgaaggccgctaccgggtcatg
cacgacggccgcagccaactggaggcgctgcgcgagcgcaccgcggcggtgatccgcagc
acccgcggcgagtacgagcacgaactgtcgccgcactggcgcggcctcagcgtgatgcgc
gaccgcctttcgcaatacctgccgccgtgggtcggtatcgccatcggcctggccttgctg
ctggccttgctgttcggcctgcggatgaagctggccgccgacgccgagccggtgttcaag
cgcatccacgccatcggcgagatcccggtgcaggccatcgaccgcccggcggtgcagccg
cgggtgatcgagcggccacgcctggcgcgcttcctcgccgacgacatcaaggcccagcga
gtggcggtggaggacgccgtcgaccgctcggtggtgaccatccgcggcgacgagctgttc
gccagcgccagcgccagcgtgcgcgacgagttccagccgctgctgctgcgcatcgccgac
gccctgcgcaaggtcaagggccaggtgctggtcaccggccatagcgacaaccggccgatc
gccacgctgcgctacccgtccaactggaaactgtcccaggcccgcgcccaggaggtcgcc
gacctgctcggcgcgaccaccggcgacgccggccgcttcaccgccgaagggcgcagcgac
accgagccggtggcgaccaatgccagcgccgaaggccgcgcacgcaaccgccgggtggaa
atcaccgtattcgcggagggcgcgcaatga

KEGG   Pseudomonas aeruginosa PAO1: PA1668Help
Entry
PA1668            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA1668
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA1668
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA1668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-GeneID: 882100
NCBI-ProteinID: NP_250359
UniProt: Q9I357
Position
1818189..1819058
Genome map
AA seq 289 aa AA seqDB search
MIKEREYHEDEKTVLLDHQGQVPAQGPLTDFAEPPRFEQLEERMIYAARLRPGEAFNVSL
NPLVAAASELLSEVVRLKHSTVLENLAALKERLTSAMKLFEFRAVQDGVENSQVMAARYV
LCTVVDEAVVTTPWGNESEWSKISLLSSFHNETFGGEKFFQLLDRLSKNPVKHLPMLELM
YLCLALGFEGKYRVMARGVLDLDGISDALYRQIRQLRGDVPRELSPHWQGLSDQRRGLVR
IVPWWMVALFTLVCLVVMYSGFAWVLGEQRDTVLQPYQSLDAAAGQPGS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggaaagggaataccacgaggacgagaagaccgtcctcctcgatcaccaggga
caggtaccggcccaggggccgctgaccgatttcgccgaaccgccgcgcttcgaacagctc
gaggagcggatgatctacgcggcgcgcctgcgtccgggcgaggccttcaacgtcagcctg
aacccgctggtggcggcggcttccgaactgctttcggaagtggtccggctcaagcacagc
accgtgctggagaaccttgcggcgctcaaggagcggttgacctccgccatgaagctcttc
gaattccgcgccgtgcaggatggcgtggaaaacagccaggtcatggcggcgcgctacgtg
ctgtgcacggtggtcgacgaggcggtggtgaccaccccgtggggcaacgaaagcgaatgg
tcgaagatcagcctgctgagcagcttccataacgagaccttcggcggcgagaagttcttc
cagttgctcgaccggctgtcgaagaacccggtcaagcacctgccgatgctggagctgatg
tacctctgcctggccctcggcttcgagggcaagtaccgggtgatggctcgcggcgtgctc
gacctggacggtatttccgatgcgctctaccggcagatccgccagttgcgcggcgacgtg
ccgcgcgaactgtcgccgcactggcaggggctcagcgaccagcgtcgcggcctggtgcgg
atcgtgccctggtggatggtggcgctgttcaccctggtctgcctggtggtgatgtattcg
ggattcgcctgggttctcggcgaacaacgcgacacggtgctgcagccttaccagtcgctc
gatgcggcggcaggacagcccggttcgtaa

KEGG   Pseudomonas aeruginosa PAO1: PA2362Help
Entry
PA2362            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA2362
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA2362
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-GeneID: 882222
NCBI-ProteinID: NP_251052
UniProt: Q9I1B7
Position
complement(2612041..2612799)
Genome map
AA seq 252 aa AA seqDB search
MPEGSAGPFSQAYQEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRR
LWRSAFASVGDAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQDKPLESHLYGSRQAGE
YLPLAIKRLLDERAPASRDLANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQRE
ADAADLGRRLEQPAAAPPRRLPVRAALPDGFRLGLAVLGLVLLMSGIGHLFWRDIQHEMA
AVTHLADAEQAP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagggagtgcagggcctttttcccaggcgtaccaggagcaaccgctcagcacg
gcattccgccaggcctggcaggaatggctggaggcctggggcgccctcgaccgggacgcc
caggatgtgccacggatggtcgagcgcgccctcgaactgtccacccgcatcacccggcgt
ctgtggcgcagcgccttcgccagcgtcggcgacgcggcgggcgtgcaggtcaaggcgatg
gtctatgccttcgtcgccctggtcgacgagaccctggtcttcagcgcctggccggggcag
ggcgcctggcaggacaaaccgctggagtcgcatctctacggcagtcgccaggcgggcgaa
tacctgccgctggcgatcaagcgcctgctcgacgaacgcgccccggccagtcgcgacctg
gccaacgtctacctgcaatgcctgatcctcggcttccgcggtcgcctgcgcgggccgcgc
ggcgaggcgctgcacgagaagtggcggcaggcattgttcgccttcgcctggcagcgcgag
gcggacgccgccgacctcggccgtcgccttgagcagcccgccgctgcgccgccacggcgt
ctgccggtgcgcgcagcgctgccggacggcttccgcctgggcctggcggtgctcgggctg
gtgctgttgatgagcggtatcggacacctgttctggcgcgacatccagcacgaaatggcg
gcggtgacccacctggccgatgcggagcaggcgccatga

DBGET integrated database retrieval system