KEGG   Pseudomonas aeruginosa PAO1: PA0080Help
Entry
PA0080            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA0080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0080
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-GeneID: 879436
NCBI-ProteinID: NP_248770
UniProt: Q9I752
Structure
PDB: 

Position
complement(97754..98218)
Genome map
AA seq 154 aa AA seqDB search
MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDT
AFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDR
ATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaactgatcgtcgcgctgttcgggctgctgctcgccgcctgttcgtccagcccg
ccggaaaccccgccgacccgggtggtgatctggctccacgccgcaccgaacctcaacccg
tccgccgccggccaggcggcgccgctgcgcctgcggctgtacgagctgaagaaagacacc
gcgttcggccgcgccgactacttcgccctcaccgacaacgcccagtcgaccctcggtggc
gacctggtggagcaggacgagttcctcctgcgtccgggcgaggaacggcgcatcgaacgc
acgctcgacgagcagacccgccagctcggtttcgtcgccgcctaccgcgacctcgaccgc
gccacctggcgccaggtcctcgacgtgccggggcaacgcaccagccatctcgacatcacg
ctcggcgcgcaggccatcggcatcgtcgcgcgtcccgcgccctga

KEGG   Pseudomonas aeruginosa PAO1: PA1666Help
Entry
PA1666            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA1666
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA1666
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-GeneID: 882020
NCBI-ProteinID: NP_250357
UniProt: Q9I359
Position
1816352..1816858
Genome map
AA seq 168 aa AA seqDB search
MSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVR
LFELKHPVAFENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVL
AAYRDLGEASWRYVVPVTAKELTRVELKLGQKGILNAGELLGKAGDAR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcgcccgatcccgccagccagggcgctggccatgctcgccgtcctggcgctg
ctggccggctgttccacgctgtcgccgtattccagactgaccaagctcgacctcgccctg
agcgccggcgagcgggtcaatcccgacctcaatggccggccgtcgccggtggtagtgcgg
ctgttcgagctgaaacacccggtggcgttcgagaacgccgacttcttcagcctctacgaa
cgtcccaaggagaccctggaccccgacctggtgaccagcgaggagctggagctgcgtccc
ggcgagcgggtcgaactcaagctcagcgtggaggaggggagccgctacgtgggcgtgctc
gccgcctaccgcgatctcggcgaggcaagctggcgctacgtggtgccggtcacggcgaaa
gagctgacccgggtagagctgaagctgggccagaagggcatcctgaatgccggcgaattg
ctcggcaaggcgggtgacgcgcgatga

DBGET integrated database retrieval system