KEGG   Pseudomonas aeruginosa PAO1: PA0081
Entry
PA0081            CDS       T00035                                 

Gene name
fha1
Definition
(RefSeq) Fha domain-containing protein
  KO
K11913  type VI secretion system protein
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02025  Biofilm formation - Pseudomonas aeruginosa
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA0081 (fha1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA0081 (fha1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0081 (fha1)
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PA0081 (fha1)
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-GeneID: 879413
NCBI-ProteinID: NP_248771
UniProt: Q9I751
Position
complement(98263..99756)
AA seq 497 aa
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGV
YYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTD
PFTSFDALMSRQAAGSAPAFAEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAP
RPDHVPAEQHDFRPPEPVIPPPPATTPAPPPAGGAPLIPADWDPFAELLGNTPAPSATPV
AQPLPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQPQPQPASVAAPTPPASAAAS
AGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLVEGLVDVLRARASLKGEFRMA
QTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQA
AIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFG
REFSRAYEEHSARLRRS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgccgctgcgattgaccatcaccagctaccacaagctgacccccggtcagtgttcggaa
aaggtactggaccagggacagctgaccatcggtcggggcccggacaacgactgggtcctg
ccggacccggagcgcctggtctccagccgccactgcaccatcctcaaccgcgacggggtg
tactacctcaccgacaccagcaccaacggcgtgctgctggtcaatgccgggcaccgcctg
cgccgcggcaacagcgagccgctgcaggacggcgagaccgtccgcctcggcgaatacgac
atcctcgtccagctcggccatgacatcgccctgcccggcagcggcaatccgcagaccgat
ccgttcaccagcttcgacgccctgatgagccggcaggccgccggatcggcgcctgccttc
gccgaaccggcgcccaccccgcaccccgcggtgacggcgcatttccagggcggctcgccg
ctggacaccaagcccgacctgttcgacttcctcaccccgccgccgcccggcgcggcgccg
cgtccggaccatgtaccggccgaacagcacgacttccgcccgccggaaccggtgatcccg
ccgccccccgcgaccaccccggcgccaccgcccgctggcggcgcaccgctgattccggcc
gactgggacccgttcgccgaactgctcggcaacacgcccgcgccaagcgccacgcccgtc
gcccagccgctgccgacggccgaaccgacgccgctggcgatgcccttcgccgacccaggg
atcacccaacagccacagccacagccacagccacagccacagccacagccacagccacag
ccacagccacagccagcgagcgtggcggcgccgacgccgccggcaagcgccgccgcgtcg
gccggcggcgacctgctgcaagcgttcctgcgcggcgccggcatgacccagttgaaggtc
gacccggccggcgccgaagcgcagatggaagccatcggccgcagctatcgcggcctggtg
gaaggactggtggacgtgctgcgcgcgcgggccagcctgaagggcgagttccgcatggcg
cagaccatgatccagccggtgcagaacaacccgctgaagttcgcgccgaacgtcgacgag
gccatgctgctcctgctgcgccgcgacaaccaggcgttcatggcgccggatcgcgcggtg
gccgacagcttcgaagacctcaaggcgcaccagctggcggtgatggccggcgtgcaggcc
gccatccgccacctgctggcgcgcttcgaaccggccgcgctggaagcccgcttcggcaag
ccggccgggctttccggcctgctgccgggggcccgccaggcacagaactgggacagtttc
accgagctgtacgcgaagatcctgcgcgaggcggaggacgacttccaggagcttttcggc
cgcgaattcagccgcgcctacgaggaacacagcgctcgactacggcgttcctga

DBGET integrated database retrieval system