KEGG   Pseudomonas aeruginosa PAO1: PA0082
Entry
PA0082            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pae00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA0082
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0082
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA0082
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-GeneID: 879402
NCBI-ProteinID: NP_248772
UniProt: Q9I750
Position
100124..101158
AA seq 344 aa
MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRAL
ASELFGRSKDLRVANLLLQSNVALDGLDGLADGLLLVRELLGQYWDGVYPLLDADDDNDP
TFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGA
FADADADALAATRRALDGAQEHALAIESGVAERVGSAQGLDLGPLRQLLRQALQVFDLYG
PQGAGESLAPGAEAVADEQVGAAPVAAVAAPAPRASGEIANREDVLRQLDRLLEYYVRHE
PSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRGPESE
NT seq 1035 nt   +upstreamnt  +downstreamnt
gtgctggatgtacccgttttgctggctgccgtatccccggactcgccctgtggcgacgat
ctggagtacgacgccgcgttcctcgaactcgaacgcatcgcccagggccaacccgagcgc
cagatgggcgatgccgtgctgcccgccgagccgccggagtggccgcgcgtacgcgcgctg
gccagcgaactgttcggccgtagcaaggacctgcgggtagccaacctgctgctgcagagc
aacgtcgccctcgacggcctggacgggctcgccgacggcctgctgctggtccgcgagctg
ctcggccagtactgggacggcgtctatccgttgctcgacgccgatgacgacaacgacccc
accttccgtatcaacgccctcaccggcctggtcgccgaaccgctgctgcaactggtctgg
gcgatcccgctggtgcgctcgcgggcgttcggcccggtcaacctgcgcgccgcgctgaac
gccgccgggctgcaacgcttcgccagcgagaccctgagtcccgagcagatcgccggcgcc
ttcgccgatgccgacgccgatgcgctggccgccacccggcgcgccctggatggcgcccag
gaacatgccctggccatcgagagcggcgtcgccgaacgggtcggctcggcccagggactc
gacctcggtccccttcgtcaactgctgcgccaggccctccaggtgttcgacctgtacggc
ccgcagggcgccggcgagtccttggcgccgggtgccgaggcggtcgccgacgagcaggtg
ggtgccgcgcctgtcgcagccgtcgccgcgccggcaccgcgagccagcggcgagatcgcc
aaccgcgaagacgtcctgcgccagctcgatcgcctgctcgagtattacgttcgccacgag
ccgtcgagtccggtgccggtgctgctcaagcgcgccaagacactggtgacggccgacttc
gccgaaatcgtgaggaatctcatccccgatgggatttcccagttcgaaaccctgcgaggc
ccggaaagcgagtaa

DBGET integrated database retrieval system