KEGG   Pseudomonas aeruginosa PAO1: PA0086
Entry
PA0086            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0086
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PA0086
SSDB
Motif
Pfam: ImpE TPR_19 TPR_14 TPR_16 BTAD
Other DBs
NCBI-GeneID: 879504
NCBI-ProteinID: NP_248776
UniProt: Q9I746
Structure
PDB: 
4UQX 4UQY 4UQZ

Position
104006..104851
AA seq 281 aa
MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLL
AVMGQWARAQNQLKVVGELDASALPMVQTYSTAIDCEALRREVFAGRLTPVILGQPAEWI
APLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAPFAWLADADTRLGPVLEVIVN
GRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVALLPARYAETVEHGDDAAR
LGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTDA
NT seq 846 nt   +upstreamnt  +downstreamnt
atggccgacccttcattcgcatccgggcgcctgggctcccggctacagggaagtatcgcg
atgatcgccgaagaactgttgcgcgccgggcgcctggacgatgccttgaaagccttgcag
gaacaggtgcgcagccagccgtcgaacgctaccctgcggatcttcctgttccagctgctg
gccgtgatgggccagtgggcgcgggcgcagaaccagctcaaggtggtcggcgaactggat
gcctcggcgctgccgatggtacagacctactccaccgccatcgactgcgaggcgctgcgc
cgcgaggtgttcgccgggcgcctgacgccggtgatcctcggccagccggcggaatggatc
gcgccgctgttgcaggccctgagcctggacgccgaaggccatggcgaggccgcccaggcc
ctgcgcgagcaggccttcgacgccgcgccggcggtgcccggtcggatcggcgaagcgccg
ttcgcctggctggcggatgccgacacgcgcctcggcccggtgctcgaggtaatcgtcaac
ggtcgctatgcctggttgccgatgagcaacctgcgcagcctcaaggtcgaggcgccgagc
gacctgcgcgatctggtctggctgccggccgaactgaccctggccaacggtggcgccacc
gtcgcgctgctgccggcgcgctacgcggaaaccgtcgagcacggcgacgacgccgcgcgc
ctgggacgcaagaccgaatggctggacagcggcctgccggtcggccagcggctgttcgtc
accgatgccggcgagaccgcgctgttcgacctgcgtgaactggacttcgagccgacggac
gcctga

DBGET integrated database retrieval system