KEGG   Pseudomonas aeruginosa PAO1: PA0091
Entry
PA0091            CDS       T00035                                 

Gene name
vgrG1
Definition
(RefSeq) type VI secretion system protein VgrG
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA0091 (vgrG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0091 (vgrG1)
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA0091 (vgrG1)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-GeneID: 879511
NCBI-ProteinID: NP_248781
UniProt: Q9I741
Structure
PDB: 
4UHV 6H3N 4MTK 6H3L

Position
110976..112907
AA seq 643 aa
MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSL
ELPGGSRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIKQ
VFRNLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHILVLS
DAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREVQPGSLTLNDYDFQRPGARLEV
RSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQAQHERVRLRGVVRGIGAGHL
FRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCIDASQSFRLLPQTP
VPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGKNWG
SMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPA
NFNEIRMEDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRTRAV
KLNDTLLVGGAKSDSVTGTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNG
NIDTGGRLDLNSGGASEVDAKGKGVQGTIDGQVQAMFPPPAKG
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgcaactgacccgcctggtccaggtggattgcccgctggggccggacgtgctgctgttg
cagcgcatggagggacgcgaggaactgggacggctgttcgcctacgagctgcacctggta
tcggaaaatcccaacctgccgctggagcagttgctcggcaagccgatgagcctgtcgctg
gagctgcccggcggcagccggcgcttctttcacggcatcgtcgcgcgctgtagccaggtg
gccgggcacggccagttcgccggctaccaggccaccctgcggccctggccgtggctgctg
acgcgcacctcggactgccgcatcttccagaaccagagcgtgccggagatcatcaagcag
gtgttccgcaacctcggcttttccgatttcgaggatgccctcacgcgcccctaccgcgag
tgggaatactgcgtgcagtaccgcgagaccagcttcgacttcatcagccggctgatggaa
caggaaggcatctactactggttccgccatgagcagaagcgccacatcctggtgctctcc
gacgcctacggcgcgcatcgcagcccgggtggctacgccagcgtgccgtactacccgccg
accctcggccatcgcgagcgcgaccacttcttcgactggcagatggcacgcgaggtccag
cccggttcgctgaccctcaacgactacgacttccagcgccccggcgcgcgcctggaggtg
cgttcgaacatcgcccggccgcacgcggcggccgactacccgctgtacgactatcccggc
gaatacgtgcagagccaggacggcgagcagtacgcgcgcaaccgcatcgaggcgatccag
gcgcagcacgagcgcgtgcgcctgcgcggcgtggtgcgcgggatcggcgccgggcacctg
ttccgcctgagcggctatccgcgcgatgaccagaaccgcgagtacctggtggtcggcgcc
gaataccgggtggtccaggaactctacgaaaccggcagcggcggcgccggctcgcagttc
gagagcgagctggactgcatcgacgccagccagtcgttccgtctcctgccgcagactccg
gtaccggtggtgcggggtccgcagaccgcggtggtggtcggacccaagggcgaggagatc
tggaccgaccagtacggccgggtcaaggtgcacttccactgggatcgccacgaccagtcg
aacgagaacagctcctgctggattcgcgtgtcccaggcctgggccgggaagaactggggt
tcgatgcagatcccgcggatcggccaggaagtgatcgtcagcttcctcgaaggcgacccg
gaccggccgatcatcaccgggcgggtctacaacgccgagcagacggtgccctacgagctg
ccggcgaacgccacccagagcgggatgaagagccgttcgagcaagggcggcacgccggcc
aacttcaacgagatccgcatggaggacaagaagggcgccgagcagttatacatccacgcc
gagcgcaaccaggacaacctggtcgagaacgatgcctcgctgtcggtcggccacgaccgc
aacaagagcatcggccacgacgagctggcgcgcatcggcaacaaccgcacccgcgcggtg
aagctcaacgacaccctgttggtgggcggggcgaagagcgacagcgtcaccggcacctac
ctgatcgaggccggcgcgcagatccgcctggtctgcggcaagagcgtggtggagttcaac
gccgacggcaccatcaatatctccggcagcgccttcaacctctacgccagcggcaacggc
aacatcgacaccggcggccgcctcgacctcaattccggcggcgccagcgaggtcgacgcc
aagggcaagggcgtgcagggcaccatcgacggccaggtacaggcgatgtttccgccgccg
gcgaagggctga

DBGET integrated database retrieval system