KEGG   Pseudomonas aeruginosa PAO1: PA0092
Entry
PA0092            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: Tsi6
Other DBs
NCBI-GeneID: 880664
NCBI-ProteinID: NP_248782
UniProt: Q9I740
Structure
PDB: 
4ZV0 4ZUY 5JTK

Position
complement(113022..113306)
AA seq 94 aa
MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIA
VKEFDETDPELSRALKDAYYVGIRTGRGLKVDLP
NT seq 285 nt   +upstreamnt  +downstreamnt
atgacacccatcgaatacatcgaccgcgctctggcgctggtcgtcgaccggctggcccgc
tatccgggatacgaggtcctgctgtctgcggaaaagcaattgcagtacatcaggtccgtc
ctgctcgaccgcagcctggatcgttccgcactgcaccggttgaccctcggcagcatcgcc
gtgaaggaattcgacgaaaccgacccggaactctccagggccctcaaggacgcctactac
gtcggtatacgcactggccgcggcctgaaggtcgatctgccctga

DBGET integrated database retrieval system