KEGG   Pseudomonas aeruginosa PAO1: PA0093
Entry
PA0093            CDS       T00035                                 

Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: Ntox46 PAAR_motif
Other DBs
NCBI-GeneID: 880654
NCBI-ProteinID: NP_248783
UniProt: Q9I739
Structure
Position
complement(113303..114595)
AA seq 430 aa
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGL
SMFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPF
PVLIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFIGGPTERVAFVLDLEEWLHTG
LEALGLAALAGGLLLAAMAGVAALVGVVAIGGLMMGGMALLGDLGDRLGPGYRDLFQGVA
GMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNLDHDINYRGNRETAAKFFKSK
DIDPADAESYMNGLDFNHPVRVETLAPGKNLWQYQSPGAPQGNWYTLSPRVQPTELGINP
MGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWSVKGQSYPAKGGAQQLFSNEKG
SFGLLPREGS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggatgcgcaagccgccgcccgactgggcgatgagatagcccacggtttcggtgtcgcc
gcgatggtcgccggagccgtggccggagccctgatcggcgccgccgtggtcgccgccacc
gccgccaccggcggcctggccgcggtgatcctggccggttcgatcgccgccggcgggctg
tcgatgttccagatcgtcaagggcctgaccaccatcttcgagctacccgagccgaccacc
ggggtgctcatacgcggcagcttcaacgtctacgtgaacagtcgcaacgcgatgcgcgcc
ggcgacgacgtttccgccacctgcagcggcctgccgctgaaccatccgctgtggccgttc
ccggtgctgatcgccgaaggcagcgcgaccgtgtacatcaacggcaagccggcggcgcgc
ctgcagagcaagatggtctgcggcgcgcacatcaagaccggcagccagaacaccttcatc
ggcggccccaccgagcgggtggccttcgtcctcgacctggaggaatggctgcacaccggc
ctcgaggcgctgggcctggcggccctagccggcggcctgctgctggcggcgatggccggg
gtcgcggcgctggttggagtggtcgccatcggcggcctgatgatgggcggcatggccctg
ctcggcgacctcggcgaccgcctcggtcccggctaccgcgacctgttccagggcgtggcg
gggatggcattgctgggcttcgggccgaaactcgccggtcgtcgtccggcagcggtgacc
tccgaaaccgcgcaacgacgcgcctacctgaacaacaagttcggtcgttccggcaacctc
gaccacgacatcaactaccgcgggaatcgtgaaaccgccgccaagttcttcaagtcgaag
gacatcgatcctgccgatgccgagtcgtacatgaacggcctggacttcaaccatccggtc
cgtgtggaaaccctcgcgcccggcaagaacctgtggcagtaccagtcccccggagcgccg
cagggcaactggtatacactcagcccgcgcgtgcagcccacggagctgggaatcaacccc
atgggcaccaaccgggcggcgaacaccatcgaacccaaggtcctcaactcctacaggacg
acccagaaggtcgaggtcctgcgcagcaccgctgcgccgaccgatgacttctggtcggta
aagggacagtcatatcccgccaaaggcggcgcgcaacaactgttctccaacgagaaaggc
tccttcggtctgcttccccgggagggatcatga

DBGET integrated database retrieval system