KEGG   Pseudomonas aeruginosa PAO1: PA0093Help
Entry
PA0093            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ntox46 PAAR_motif
Motif
Other DBs
NCBI-GeneID: 880654
NCBI-ProteinID: NP_248783
UniProt: Q9I739
Structure
PDB: 

Position
complement(113303..114595)
Genome map
AA seq 430 aa AA seqDB search
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGL
SMFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPF
PVLIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFIGGPTERVAFVLDLEEWLHTG
LEALGLAALAGGLLLAAMAGVAALVGVVAIGGLMMGGMALLGDLGDRLGPGYRDLFQGVA
GMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNLDHDINYRGNRETAAKFFKSK
DIDPADAESYMNGLDFNHPVRVETLAPGKNLWQYQSPGAPQGNWYTLSPRVQPTELGINP
MGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWSVKGQSYPAKGGAQQLFSNEKG
SFGLLPREGS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgcaagccgccgcccgactgggcgatgagatagcccacggtttcggtgtcgcc
gcgatggtcgccggagccgtggccggagccctgatcggcgccgccgtggtcgccgccacc
gccgccaccggcggcctggccgcggtgatcctggccggttcgatcgccgccggcgggctg
tcgatgttccagatcgtcaagggcctgaccaccatcttcgagctacccgagccgaccacc
ggggtgctcatacgcggcagcttcaacgtctacgtgaacagtcgcaacgcgatgcgcgcc
ggcgacgacgtttccgccacctgcagcggcctgccgctgaaccatccgctgtggccgttc
ccggtgctgatcgccgaaggcagcgcgaccgtgtacatcaacggcaagccggcggcgcgc
ctgcagagcaagatggtctgcggcgcgcacatcaagaccggcagccagaacaccttcatc
ggcggccccaccgagcgggtggccttcgtcctcgacctggaggaatggctgcacaccggc
ctcgaggcgctgggcctggcggccctagccggcggcctgctgctggcggcgatggccggg
gtcgcggcgctggttggagtggtcgccatcggcggcctgatgatgggcggcatggccctg
ctcggcgacctcggcgaccgcctcggtcccggctaccgcgacctgttccagggcgtggcg
gggatggcattgctgggcttcgggccgaaactcgccggtcgtcgtccggcagcggtgacc
tccgaaaccgcgcaacgacgcgcctacctgaacaacaagttcggtcgttccggcaacctc
gaccacgacatcaactaccgcgggaatcgtgaaaccgccgccaagttcttcaagtcgaag
gacatcgatcctgccgatgccgagtcgtacatgaacggcctggacttcaaccatccggtc
cgtgtggaaaccctcgcgcccggcaagaacctgtggcagtaccagtcccccggagcgccg
cagggcaactggtatacactcagcccgcgcgtgcagcccacggagctgggaatcaacccc
atgggcaccaaccgggcggcgaacaccatcgaacccaaggtcctcaactcctacaggacg
acccagaaggtcgaggtcctgcgcagcaccgctgcgccgaccgatgacttctggtcggta
aagggacagtcatatcccgccaaaggcggcgcgcaacaactgttctccaacgagaaaggc
tccttcggtctgcttccccgggagggatcatga

DBGET integrated database retrieval system