KEGG   Pseudomonas aeruginosa PAO1: PA0094
Entry
PA0094            CDS       T00035                                 

Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: DcrB PsbP_2
Other DBs
NCBI-GeneID: 879595
NCBI-ProteinID: NP_248784
UniProt: Q9I738
Structure
Position
complement(114611..115045)
AA seq 144 aa
MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDASQGDAPFADYVARQLE
NAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQVFIERRPAVLITTLTTTP
ADLPHHEPAWKQAMQTLVPRPTPS
NT seq 435 nt   +upstreamnt  +downstreamnt
gtgacgctctatcgcctccacgaagccgatctcgagattcccgatgcctggcaggaccag
agcatcaacatcttcaagctccccgccagcggccccgcccgcgaagccagtttcgtcatc
agccgtgacgccagccagggcgacgcgccgttcgccgactatgtcgcccgccaactggaa
aacgccgagaagcaattgcccggcttcaagctgcacaagcgctgggacatcaacatccac
ggccacgccgccgtgctcctcgactaccagtggcagcgcgagggccgcgacctgatgctg
cgccaggtattcatcgagcgccgcccggcggtgctgatcaccaccctgaccaccaccccg
gctgacctgccgcaccacgagccggcctggaagcaggcgatgcagaccctggtcccgcgc
ccgacccctagctga

DBGET integrated database retrieval system