KEGG   Pseudomonas aeruginosa PAO1: PA0095Help
Entry
PA0095            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA0095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0095
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C
Motif
Other DBs
NCBI-GeneID: 880726
NCBI-ProteinID: NP_248785
UniProt: Q9I737
Position
115299..117524
Genome map
AA seq 741 aa AA seqDB search
MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISENPDLPLDGLLGKPAS
LALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDI
IKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEQSRHIL
VLSDAYGAHQSPPNYASVPYYPPTLEQRERDHFYDWHMAREVQSGSLSLNDYDFQRPGAR
LEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIEALQARYERVRLRGRARGLGS
GHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVGAQFESELDCIDAGQAYRPLP
TTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGG
TPANFNEIRMEDKKGAEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRT
ETVDNNETITIGVDRTEKVGNNEKISIGANRTEDVGSNETISIGVDRTEKVGSNEKISIG
ANRTEDVGNDETISIGANRSESVGNNETISIGADRSESVGANETIDIGGNQSTSIGKNES
RSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLVTGAASIRMKKDGSIVISGKNITIDGS
GAINVKADKNVVVKGRKILQN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcgcaacagacccgcctggtccgggtcgacagtccgctcggcgcggaggtc
ctgcaattgcagcgaatggagggtcgcgaagagctcggccggccgttcgcctacgagctg
gaactgatctcggaaaaccccgacctgccactcgacgggctgctgggcaagccggccagc
ctggcgctggaactgcacgacggcagccggcggcatttccacggcatcgtcgccgcttgc
agccagggatccggcaacggccagttcgccagctaccaggtcaccctgcgcccctggctg
tggctgctgacgcgcacctccgactgccgcatcttccagaaccagaaggtcccggacatc
atcaagcaggtgttccgcgacctcggcttctccgacttcgaggacgccctgagccgctcc
taccgcgagtgggaatactgcgtgcagtaccgcgagaccagtttcgacttcgtcagccgg
ctgatggagcaggaaggcatctactactggttccgccacgagcagagccgccacatcctg
gtgctctccgacgcctacggcgcgcaccagagcccgccgaactacgccagcgtgccctac
tacccgccgaccctggaacagcgcgagcgcgaccatttctacgactggcacatggcgcgc
gaggtgcagtccggctcgctgagcctcaacgactacgacttccagcgtcccggcgcgcgc
ctggaggtgcgttcgaacatcgcccgctcgcacgcggcggccgactacccgctgtacgac
taccccggcgaatacgtgcagagccaggacggcgagcagtacgcgcggacccgtatcgaa
gccttgcaggcgcgctacgaacgggtgcgcctgcgcggccgcgcccgcggcctgggttcg
ggccacctgttcaagctcagcggctacccgcgcgaggaccagaaccgcgagtacctggtg
gtcggcgccgagtaccgggtggtccaggaactctacgagaccggcggcggcggggtcggc
gcgcagttcgagagcgagctggactgcatcgatgccggccaggcctaccgccccttgccg
accactccgctgccgatcgtccgtggcccgcagactgcggtggtggtcgggcccaagggc
gaggagatctggaccgaccagtacggccgggtcaaggtgcacttccactgggatcgccac
gaccagtcgaacgagaacagctcctgctggattcgcgtgtcccaggcctgggccgggaag
aactggggttcgatgcagatcccgcggatcggccaggaagtgatcgtcagcttcctcgaa
ggcgacccggaccggccgatcatcaccgggcgggtctacaacgccgagcagacggtgccc
tacgagctgccggcgaacgccacccagagcgggatgaagagccgttcgagcaagggcggc
acgccggccaacttcaacgagatccgcatggaggacaagaagggcgccgagcagttgttc
atccatgccgagaagaaccaggacatcgaggtcgagaacgacgagacccactgggtcggc
cacgaccggaccaagaccatcgaccacgacgagaccgtgcacgtgaagcacgatcgcacc
gagaccgtggacaacaacgagaccataaccatcggcgtcgaccgcaccgagaaggtcggc
aacaacgagaagatcagtatcggcgcgaaccgcaccgaggacgtcggcagcaacgagacc
atcagcatcggcgtcgaccgcaccgagaaggtcggcagcaacgagaagatcagcatcggt
gccaatcgcaccgaggacgtcggcaacgacgagaccatcagcatcggcgcgaaccgtagc
gagtcggtgggcaacaacgagacgatcagcatcggcgccgaccgcagcgagtcggtgggc
gccaacgagaccatcgacataggcggcaaccagagcaccagcatcggcaagaacgagtcg
cgcagcgtcggccagggccgcgatacctcggtgggcaaggacgatagcctggacgtgggc
aagagcttcacgctcaacgccggcgactcgatcaccctggtcaccggtgccgccagcatc
cgcatgaagaaggacggcagcatcgtcatcagcggcaagaacatcaccatcgacggatcc
ggggcgatcaacgtcaaggccgacaagaacgtggtggtgaagggacgcaagatcctccag
aactga

DBGET integrated database retrieval system