KEGG   Pseudomonas aeruginosa PAO1: PA0099
Entry
PA0099            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: Tox-GHH2 DUF4150 DUF4423
Other DBs
NCBI-GeneID: 880737
NCBI-ProteinID: NP_248789
UniProt: Q9I733
Position
120164..121324
AA seq 386 aa
MANEVYANNMEISCKAANGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTR
TIRITRKEVMLKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVR
HLDLTTHNHASFPGNTPVWPYLDQATVDAGGGPCSNEVKKEKKDCADFKPHGSKDACAGL
GAGKPSGKKTSNEADRLADKVAARKCLTARRCALQPYKPNSCCPQQTAHHLIEASALHDK
GRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMHTFQSAAAAKSRSGTLQLSNG
SSISAKKTTYGTAKRQSMAAMGKVFPQSKCSKECLSAQLDNYHKQCGINARTPIKAVETG
QTDVTAATQAIKTRNARLGATRSRVR
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggccaacgaggtgtacgccaacaacatggagatctcctgcaaggcggcgaacggcaag
tccatcgcggccttcccggatgtctgcttcaccccgccgcaggcgccgccgacgccgttg
ggggtaccgatcccctaccccaataccggcctgtccaaggacaccaccaaaggcacccgg
accattcgcatcacccgcaaggaggtgatgctgaagaacaagagctactacaagaccagc
tacggcgacgagccggggcgggcgccgaagaagggcatcgtcaccagcaagatcaagggc
aaggtgtacttcacctcctggtcgatgaacgtcaagttcgaaagcaagaacgtggttcgc
cacctcgacctgaccacccacaaccacgcgtcctttcctggcaatacgccggtctggccc
tacctcgaccaggccaccgtcgatgctggtggtggaccgtgcagcaatgaagtgaagaag
gagaagaaggattgcgctgacttcaagccgcatggcagcaaggatgcctgcgctggcctt
ggcgcgggcaagccttccggcaagaagaccagcaacgaagctgaccgactggcagacaag
gtcgctgcccgaaaatgcctgaccgcgcgccggtgtgccctgcaaccgtacaagccgaac
agttgctgcccgcagcagaccgctcaccacctgatcgaggccagcgccttgcacgacaag
ggacgtggtggaaaaggctcggtacccctcaaggggatatccaactattcggagaacaag
gctccttgcgtctgcgcggagggcgtcaatcagaacgtgggtacccacggcctcatgcac
acgttccagagcgccgctgccgcgaagtcgcgcagtggaaccctgcaattgtccaatggc
agctccatctccgcgaagaagaccacctacggaacggcgaaacgtcaatccatggctgcc
atgggcaaggtctttccgcagtcgaaatgctcgaaggaatgtctgtccgctcagctcgac
aactatcacaagcagtgcggaatcaacgccagaacacccatcaaggccgttgaaaccggc
cagaccgacgtcacggctgcgacgcaggcgataaagacccgcaatgcgcgtcttggcgcc
acgaggagtcgagtccgctag

DBGET integrated database retrieval system