KEGG   Pseudomonas aeruginosa PAO1: PA0102
Entry
PA0102            CDS       T00035                                 

Definition
(RefSeq) carbonic anhydrase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00910  Nitrogen metabolism
pae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PA0102
Enzymes [BR:pae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     PA0102
SSDB
Motif
Pfam: Pro_CA Flp_Fap
Other DBs
NCBI-GeneID: 880767
NCBI-ProteinID: NP_248792
UniProt: Q9I730
Position
123871..124599
AA seq 242 aa
MPDRMRGVKSDSPEQESADDALKRIVDGFQHFRREVFPEQQALFKKLANSQRPRAMFITC
ADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAIEYAVLALGVHHIIVCGHS
DCGAMRAVLDPQTLERMPTVKAWLRHAEVARTVVADNCDCGASHDTLGVLTEENVVAQLD
HLRTHPSVASRLASGQLFIHGWVYDIESAQIRAYDAKQGRFLPLDGEHPVPMATPAPRYL
SS
NT seq 729 nt   +upstreamnt  +downstreamnt
atgccagaccgtatgcggggcgttaagtccgattctccagagcaggaaagcgctgacgat
gcattgaaaaggattgtcgatggattccagcatttccgccgggaggtctttcccgagcag
caggcgctgttcaagaagctcgccaatagccagcggccgcgggcgatgttcatcacctgc
gcggattcgcgcatcgttcccgagctgatcacccagagttcccccggcgacctgttcgtc
acccgcaacgtcggcaacgtggtgccgccctacgggcagatgaacggtggcgtctccacc
gccatcgaatacgctgtgctggcgctgggcgtgcaccacatcatcgtctgcggccactcc
gactgcggggcgatgcgcgccgtgctcgacccgcagaccctggaacgcatgccgacggtc
aaggcctggctgcggcacgccgaggtggcacgcacggtggtggcggacaactgcgactgc
ggcgccagccacgacaccctcggggtgctcaccgaagagaacgtggtggcccagctcgat
cacctgcgcacccacccctcggtggcctcgcgcctggccagcgggcaactgttcatccac
ggctgggtgtacgacatcgagagtgcgcagatccgcgcctacgacgccaagcagggtcgc
ttcctgcccctcgacggcgagcatccggtgccgatggccacgcccgcgccgcgctacctg
agctcgtga

DBGET integrated database retrieval system