KEGG   Pseudomonas aeruginosa PAO1: PA0115
Entry
PA0115            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K02348  ElaA protein
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    PA0115
SSDB
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 Acetyltransf_9 Acetyltransf_CG
Other DBs
NCBI-GeneID: 880693
NCBI-ProteinID: NP_248805
UniProt: Q9I717
Structure
PDB: 
1XEB

Position
complement(135934..136386)
AA seq 150 aa
MSLDWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQEVDGLDLVGDTHHLMAWRDGQL
LAYLRLLDPVRHEGQVVIGRVVSSSAARGQGLGHQLMERALQAAERLWLDTPVYLSAQAH
LQAYYGRYGFVAVTEVYLEDDIPHIGMRRA
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtcgctcgactggacctgcaagcaccacgccgacctcaccctgaaggaactctacgca
ctgctgcaattgcgcaccgaggtcttcgtggtggaacagaaatgcccctaccaggaagtc
gacggcctcgacctggtcggcgatacccatcacctgatggcctggcgcgacggccagttg
ctcgcctacctgcgcctgctggacccggttcgccacgagggccaggtggtgatcggccgg
gtggtcagttcctcggccgcgcgcggccaggggctcggtcaccagttgatggaacgcgcg
ctgcaggcggcggagcgcctctggctggacaccccggtgtacctctcggcccaggcccac
ctgcaggcctactacggccgctatggcttcgtcgcggtcaccgaggtctacctggaagac
gacatcccgcacatcggcatgcgccgggcctga

DBGET integrated database retrieval system