KEGG   Pseudomonas aeruginosa PAO1: PA0156
Entry
PA0156            CDS       T00035                                 
Name
(RefSeq) resistance-nodulation-cell division (RND) efflux membrane fusion protein
  KO
K21136  membrane fusion protein, multidrug efflux system
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA0156
Transporters [BR:pae02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   PA0156
SSDB
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 Biotin_lipoyl OEP YqfD
Other DBs
NCBI-GeneID: 882149
NCBI-ProteinID: NP_248846
UniProt: Q9I6X6
Structure
Position
177307..178458
AA seq 383 aa
MSDARGAFHSKGRWSRMALPAILCAGLLVGCGAEPPAEEHVRVLAQTVKMAEFASATSIT
GDIQARVQADQSFRVGGKIVERLVDVGDHVAAGQVLARLDPQDQRSNVENAQAAVAAQQA
QSKLADLNYQRQKALLPKGYTSQSEYDQALASVRSAQSSLKAAQAQLANARDLLSYTELR
ASDAGVITARQAEVGQVVQATVPIFTLARDGERDAVFNVYESLFSHDVDGQRITVSLLGK
PEVTASGKVREITPTVDERSGTLKVKVGLDSVPAEMSLGSVVNASVAAPAEHSVVLPWSA
LSKVGEQPAVWLLDQQGKARLQPVRVARYASEKVVIDGGLEAGQTVVTVGGQLLHPGQVV
EVAQPPQPTQSTASRDAVGGGQP
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgtcagacgccagaggcgcttttcattccaaaggtcgctggtcgcggatggcgctgccc
gccatcctgtgcgccggcctgcttgtcggttgcggcgccgagccgcccgccgaggaacac
gtccgtgtgctggcgcagacggtgaagatggccgagttcgcctcggccacctcgatcacc
ggcgacatccaggcacgggtacaggccgaccagtcgttccgtgtcggcggcaagatcgtc
gagcgcctggtcgatgtcggcgaccacgtcgcggctggccaggtgctggcgcggctcgac
ccgcaggaccagcgcagcaacgtggagaacgcccaggcggcggtcgccgcgcagcaggcg
cagtcgaagctcgccgacctcaactaccagcggcagaaggcgctgctgcccaagggctac
accagccagagcgagtacgaccaggcgctggcctcggtgcgcagcgcgcagagttcgctg
aaggccgcccaggcgcagttggccaacgcccgcgacctgctttcctataccgagctgcgt
gcctccgacgccggggtcatcaccgcccgccaggccgaggtcggccaggtggtgcaggcc
accgtgccgatcttcaccctggcccgcgacggcgagcgcgacgcggtgttcaacgtctac
gagtcgttgttcagccacgatgtcgacggccagcggatcaccgtcagcctgctcggcaag
ccggaagtcaccgccagcggcaaggtccgcgagatcacccccacggtggacgagcgcagc
ggtacgctgaaggtcaaggtcggcctcgactcggtgccggcggaaatgagcctcggcagc
gtggtcaacgccagcgtcgccgcgccggccgagcacagcgtggtgctgccctggtcggcg
ctgtccaaggtcggcgagcagccggcggtctggttgctcgaccagcaaggcaaggcgcgt
ctgcaaccggtgcgggtggcacgctacgccagcgagaaggtggtcatcgacggtggcctg
gaggcgggccagacggtggtcacggtgggcggccaactgctccatccgggccaggtggtc
gaggtggcccagccgccgcagccgacccagagcaccgccagccgcgacgccgtgggcgga
ggccagccatga

DBGET integrated database retrieval system